1752322143 (01752322143)
Who called me from phone number 1752322143 Plymouth
Who called me from 1752322143
Phone number 1752322143 it's a landline number from Plymouth. This phone number has been searched 1 times. The first search was on 2026-02-16 08:34:51 and the last on 2026-02-16 09:35:51. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1752322143 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441752
Phone number 1752322143 - 0 opinions
Reviews for phone number 1752322143
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1752322143
QR Codes for number +44 1752322143




Phone number 1752322143 (+441752322143)
Country: United Kingdom
Country code: +44 (0044)
City: Plymouth
Directional local: 1752 (01752)
Code: 441752 (00441752)
This number was searched 1 times
First date of search: 2026-02-16 08:34:51
Date of last check of this number: 2026-02-16 09:35:51
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 412232571
A similar number: 175232989, 175232760, 175232949, 175232996, 173032214, 173032214, 176032214, 177032214(17 52 32 989,17 52 32 760,17 52 32 949,17 52 32 996,17 30 32 214,17 30 32 214,17 60 32 214,17 70 32 214)
Previous phone numbers: 1752322142 1752322141 1752322140 1752322139 1752322138 1752322137 1752322136 1752322135 1752322134 1752322133 1752322132 1752322131 1752322130 1752322129 1752322128 1752322127 1752322126 1752322125 1752322124 1752322123 1752322122 1752322121 1752322120 1752322119 1752322118 1752322117 1752322116 1752322115 1752322114 1752322113 1752322112 1752322111 1752322110 1752322109 1752322108 1752322107 1752322106 1752322105 1752322104 1752322103 1752322102 1752322101 1752322100 1752322099 1752322098 1752322097 1752322096 1752322095 1752322094 1752322093 1752322092 1752322091 1752322090 1752322089 1752322088 1752322087 1752322086 1752322085 1752322084 1752322083 1752322082 1752322081 1752322080 1752322079
Next phone numbers: 1752322144 1752322145 1752322146 1752322147 1752322148 1752322149 1752322150 1752322151 1752322152 1752322153 1752322154 1752322155 1752322156 1752322157 1752322158 1752322159 1752322160 1752322161 1752322162 1752322163 1752322164 1752322165 1752322166 1752322167 1752322168 1752322169 1752322170 1752322171 1752322171 1752322172 1752322173 1752322174 1752322175 1752322176 1752322177 1752322178 1752322179 1752322180 1752322181 1752322182 1752322183 1752322184 1752322185 1752322186 1752322187 1752322188 1752322189 1752322190 1752322191 1752322192 1752322193 1752322194 1752322195 1752322196 1752322197 1752322198 1752322199 1752322200 1752322201 1752322202 1752322203 1752322204 1752322205 1752322206 1752322207 1752322208 1752322209 1752322210 1752322212 1752322212 1752322213
(Previous phone numbers: 01752322142 01752322141 01752322140 01752322139 01752322138 01752322137 01752322136 01752322135 01752322134 01752322133 01752322132 01752322131 01752322130 01752322129 01752322128 01752322127 01752322126 01752322125 01752322124 01752322123 01752322122 01752322121 01752322120 01752322119 01752322118 01752322117 01752322116 01752322115 01752322114 01752322113 01752322112 01752322111 01752322110 01752322109 01752322108 01752322107 01752322106 01752322105 01752322104 01752322103 01752322102
Next phone numbers: 01752322144 01752322145 01752322146 01752322147 01752322148 01752322149 01752322150 01752322151 01752322152 01752322153 01752322154 01752322155 01752322156 01752322157 01752322158 01752322159 01752322160 01752322161 01752322162 01752322163 01752322164 01752322165 01752322166 01752322167 01752322168 01752322169 01752322170 01752322171 01752322171 01752322172 01752322173 01752322174 01752322175 01752322176 01752322177 01752322178 01752322179 01752322180 01752322181 01752322181 01752322182)
+44 01752322143 reviews
Add your opinion about +441752322143
UK 1752322143
free play store app
Who called from number 1752322143
You can rate other simmilar phone numbers from Plymouth, searched in our database
| 1752355976 | 1752398757 | 1752330271 |
| 1752401667 | 1752649932 | 1752456590 |
Random searched phone numbers
| 782 930 9267 | 350 642 5732 | 848 745 2183 |
| 281 402 8954 | 993 431 53 | 675 903 9859 |
Top rated phone numbers
1527419033 Fraud7834491963 emily sim haverhill suffolk
7712126981 Hook
7507709573 LONDON
1213680738 Clinical trials company I signed up for a medical trial and they called me back We discussed the details I don t think that they call you without a request
2039979202 Call from O2 offering 40 off recent contract
7841706052 CHRISTCHURCH
1416477263 Fraud
491794659494 SCAM
1294679374 Had a call from BT saying my broadband connection was having faults and they needed me to access my computer I believe this is a SCAM
1698552527 Ring me at 606 on a Sunday morning And put the phone done once I answered
1202137148 SCAM - addressed me by my name and verified my address The lady basically said that my fibre-glass wool loft insulation is no longer valid and they in my area tomorrow doing surveys in the neighbouring roads I said that I was in the property business and I have not heard of this and I would need to look into it And guess what he phone went dead How rude not even a goodbye
989339584828 Courier
1226705285 A con tell them to get stuffedthen try ringing back the numberyou can tseems like this is becoming common now
7950175543 rjp asset management leamington spa war
1789417385 httpsskidsononline
1494267678 Who is this
7723076334 imedok ltd purfleet essex
1617967969 had missed call from this number im on payasyougo phone no credit to ring back just wonder who it might be
168128731 This number connects to a company claiming to be HMRC but you cannot call this number it will call u and connect They will say you have outstanding tax due and try and get a payment from you over the phone they will even send emails with fake letters from the revenue to back there case These are scammers
1702337680 rakela hair fashion ltd westcliif-on-sea essex
1200076676 If you ring number says not been recognisedis this a scam
1933806205 Please take me off your mailing list I do not want to recieve these calls
1292261497 Mudo y en mi movil sale la marca como si hubiera llamado yo
7500374347 joshua briant gravesend gravesend
1204922600 they said they will give a job in pune but telling me to register for rs 2000 n will offer me a job of 3-35lk pa
7706092242 BASILDON
1723378042 Silent call
9100048049 Unknown caller - recorded message
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
Number popularity chart 1752322143
Your opinion about telephone number 1752322143 (175 232 2143)
Phone Number Check: Called Plymouth ??? Add your opinion about this phone number, maybe you know who called from number 1752 322 143? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. Free play store app. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 017 52 32 214) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 01752322143 01752-322-143
+441752322143 |
00441752322143 |
1752 322 143 |
17 52 32 214 3 |
175 23 22 14 3 |
17-52-32-214 3 |
0044 1752-322-143 |
00 44 175 23 22 143 |
(+44)1752322143 |
17 52 32 214 3 |
(17) 5232 214 3 |
00 44 (17)5 23-22-14-3 |
+441752322143 In words... 175 232 2143
one thousand seven hundred fifty two three hundred twenty two one hundred forty three |
one seven five two three two two one four |
Possible number records of 1752322143
Last rated phone numbers
1803605359, 2045792453, 919229043193, 2045385434, 7704045454, 7921645711, 1913891632, 1619647939, 3303413407, 7812468297, 1494675111, 1902504285, 3303413046, 7391188080, 7565827573, 794326956, 2045381051, 1505287992, 2034249677, 7822000181, 7980876918, 7496033634, 1156461231, 7731317244, 1622419732, 7388, 3308182770, 1158775185, 7340675559, 3303413046, 3450130151, 2034107527, 1313812776, 1357333036, 7467321303, 7951257876, 2038687234, 2079304405, 7511, 7778356973, 7925730483, 1803605359, 7462, 1902937417, 2045866429, 2035144679, 1282792559, 1482293852, 1620823450, 6093085291,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985038718
- Pageviews today : 496728
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1752322143
+441752322143
Coventry
Fraud
Called and said they wanted to discuss my Vodaphone order. Told them no, no, no , no etc. and they hung up.
It was a recruiter from Booking.com. Seemed like a nice guy and was able to give me some useful info.
Robotic voice say thank you for order placed from amazon saying I have been charged
Another automated call about 2 transactions of money taken out of account.annoying
Silent call
Clinical trials company, I signed up for a medical trial and they called me back. We discussed the details. I don t think that they call you without a request.
SCAM - Recorded message claiming to be from HMRC. Blocked and reported.
SCAM
Fraud threats claiming to be from national insurance department
SCAM
I am a talktalk customer, and also registered with the TPS but still they call nearly every day.I have asked them not to call and told them about TPS but it makes no differance.
darby costello manchester greater manchester
The overall rating for phone number 02476685716 is Dangerous
Bank Scam Call.
This is NOT a trustworthy caller. They are pretending to be a Windows Technical Centre. It is a SCAM. (Re-reported as I misunderstood the rating previously)
SCAM / SPAM
I’ve had a spate of calls this week. Here are the numbers: n01628 435057 Maidenhead n01585 143765 UK n01089 669067 UK n01361 962860 UK n01287 923999 UK n0121 539 8559 Birmingha...
penrhyn pre-school walthamstow london
Phonepe customer care number 7605852409==7645922878
SCAM / SPAM Recorded message about internet service provider
Private number
Nottingham
had a call off this number, didnt recognise it so didnt answer and i dont know anyone in Henley On Thames, no message left so put on block list.
SCAM, Called to my mobile and knew my first name. Asked me how my trading was going? I asked where they were calling from and they said from the monitoring department. When pushed from what company didn't give an answer. They were obviously trying to get any useful information out of me. I hang up. 4/2/21
Manchester
I received an automated call about some money taken from my card. If I wanted to learn more press 1 they requested. The call was from Nakhichevan Russian Federation - I never had any connection with this part of world. Must be a fraud?!
SCAM ... Indian who told me my Visa card had an attempt made on it to transfer funds overseas, originating from Western Australia. Started asking me if I also did transactions on the computer or internet with my account. I asked him why he needed to know that and he hung up.
karen mills london london
Fraud - was a threatening recorded message saying that I would be arrested immediately if i didn't press 1
London
miguel mansfield london xx
Hythe
Silent call. Call cut immediately I answered.
tuneintv london n a
subtle projects ltd warwick warwick
BIRMINGHAM
Isleworth
maidstone
Fraud Claim to be HMRC for a tax fraud case
SCAM / SPAM repeated calls with automated message about insulation. No relation to me.
Courier
Foreign person called my business number and said they were from EDF ringing about my electric and gas. I said we didn't have gas and they hung up. Possible call centre or possible scam.
West Malling
Altrincham
Vikram Kumar
Bank/Lonas
Positive number
Very trustworthy
Don't know who this is, a computer voice just said "Goodbye" after I picked the phone up!
WIRRAL
Well dodgy, spoof number, not real - look at the pattern of digits. they re too lazy to move their fingers around the keypad. A regular caller.
Fraud
Same here. That man is annoying. Gave nothing and said to be deleted from their database and hangup. It was his second call for a week so far
Fraud
SPAM
London
SCAM This number is an automated message saying your NI number has been suspended for fraud. When the number is called back it is not possible to be connected Block
portsmouth
There is a very strange person... man or woman I’m not sure. They are parading on the dating site Plenty of Fish as a man called Joel, aged 59 (whilst the pictures are clearly of a younger man) who is meant to have a graduate degree and be an engineer working in London. Because I am suspicious due to being catfished 3 times already on this site, I asked him for his number so that he could send me a selfie. When entered into WhatsApp it came up as a business number. I asked him/her to send a live selfie an
Claims to be from the fraud unit saying that some body is using my Nat Ins Number for fraudulent transactions is from a recorded message telling to dial 1 to speak to a officer I did not dial
IT'S A DANGEROUS SCAM! A computer is dialling numbers in sequence to sniff out voice lines. If you speak then the line is detected as 'an active voice line' and logged as such, a scammer will then be calling you later! If you don't recognize the number calling DON'T SPEAK, JUST LISTEN! If you don't hear a voice and then the line goes dead then congratulations - you have just successfully escaped being scammed! THESE CALLS ARE HARASSING AND ALWAYS POTENTIALLY DANGEROUS!
forever alive preston lancs
freddy bird bristol bristol
don't know this didn't answer it
I didn't pick up and no message was left. Assume this is the usual PPI or some other cold caller.
Peterborough
London
91+
callers like this have an agenda and should not be trusted. As soon as you answer they hang up in the hope you will call them back. The number you call will be redirected to G...
SCAM text claiming to be from NHS saying close contact with a positive test person, gives a link to follow for a “free” test kit but asks for postage therefore your bank details
Banbury
SCAM
No idea who this is calling me dont know anyone in Leeds or have any business services so I feel its yet another scam if anyone knows different please post info who this is ?
Bank/Lonas
Ipswich
Friendly number
SCAM Chinese Facebook dating scam usually African Indian scammer
ELLESMERE PORT
SCAM
Trying to sell you shit
Bank/Lonas
Somebody just called asked my name and when i said Yes that me they hanged up.
These people are pain in the Arse!!! The number needs to get Blacklisted to stop the people making the annoying calls sometimes at stupid hours!! Sometimes line goes dead
Missed call want to know who it is
Burnham On Crouch
SCAM / SPAM Flash Expert Guidance. A robot asking me if I had had a no fault accident. I say YES. The very same voice came on the phone, and when I pointed that out, she hung up. Scumbag.
SPAM
emily sim haverhill suffolk
craig doran london london
nimbus ninety ltd reading reading
mobile rang a couple of times I tried to call back but operator said the number was not recognized. In view of the above comments about the high charge I guess I was lucky.
near u ltd st albans hrt
cold calling tossers. They should be shot
Silent call
Missed call
Fraud
website nottingham nottinghamshire
emenac soft london london