1752360327 (01752360327)
Who called me from phone number 1752360327 Plymouth
Who called me from 1752360327
Phone number 1752360327 it's a landline number from Plymouth. This phone number has been searched 1 times. The first search was on 2026-02-16 08:36:08 and the last on 2026-02-16 09:37:08. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1752360327 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441752
Phone number 1752360327 - 0 opinions
Reviews for phone number 1752360327
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1752360327
QR Codes for number +44 1752360327




Phone number 1752360327 (+441752360327)
Country: United Kingdom
Country code: +44 (0044)
City: Plymouth
Directional local: 1752 (01752)
Code: 441752 (00441752)
This number was searched 1 times
First date of search: 2026-02-16 08:36:08
Date of last check of this number: 2026-02-16 09:37:08
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 230632571
A similar number: 175236353, 175236201, 175236455, 175236348, 178336032, 178336032, 173936032, 179836032(17 52 36 353,17 52 36 201,17 52 36 455,17 52 36 348,17 83 36 032,17 83 36 032,17 39 36 032,17 98 36 032)
Previous phone numbers: 1752360326 1752360325 1752360324 1752360323 1752360322 1752360321 1752360320 1752360319 1752360318 1752360317 1752360316 1752360315 1752360314 1752360313 1752360312 1752360311 1752360310 1752360309 1752360308 1752360307 1752360306 1752360305 1752360304 1752360303 1752360302 1752360301 1752360300 1752360299 1752360298 1752360297 1752360296 1752360295 1752360294 1752360293 1752360292 1752360291 1752360290 1752360289 1752360288 1752360287 1752360286 1752360285 1752360284 1752360283 1752360282 1752360281 1752360280 1752360279 1752360278 1752360277 1752360276 1752360275 1752360274 1752360273 1752360272 1752360271 1752360270 1752360269 1752360268 1752360267 1752360266 1752360265 1752360264 1752360263
Next phone numbers: 1752360328 1752360329 1752360330 1752360331 1752360332 1752360333 1752360334 1752360335 1752360336 1752360337 1752360338 1752360339 1752360340 1752360341 1752360342 1752360343 1752360344 1752360345 1752360346 1752360347 1752360348 1752360349 1752360350 1752360351 1752360352 1752360353 1752360354 1752360355 1752360355 1752360356 1752360357 1752360358 1752360359 1752360360 1752360361 1752360362 1752360363 1752360364 1752360365 1752360366 1752360367 1752360368 1752360369 1752360370 1752360371 1752360372 1752360373 1752360374 1752360375 1752360376 1752360377 1752360378 1752360379 1752360380 1752360381 1752360382 1752360383 1752360384 1752360385 1752360386 1752360387 1752360388 1752360389 1752360390 1752360391 1752360392 1752360393 1752360394 1752360396 1752360396 1752360397
(Previous phone numbers: 01752360326 01752360325 01752360324 01752360323 01752360322 01752360321 01752360320 01752360319 01752360318 01752360317 01752360316 01752360315 01752360314 01752360313 01752360312 01752360311 01752360310 01752360309 01752360308 01752360307 01752360306 01752360305 01752360304 01752360303 01752360302 01752360301 01752360300 01752360299 01752360298 01752360297 01752360296 01752360295 01752360294 01752360293 01752360292 01752360291 01752360290 01752360289 01752360288 01752360287 01752360286
Next phone numbers: 01752360328 01752360329 01752360330 01752360331 01752360332 01752360333 01752360334 01752360335 01752360336 01752360337 01752360338 01752360339 01752360340 01752360341 01752360342 01752360343 01752360344 01752360345 01752360346 01752360347 01752360348 01752360349 01752360350 01752360351 01752360352 01752360353 01752360354 01752360355 01752360355 01752360356 01752360357 01752360358 01752360359 01752360360 01752360361 01752360362 01752360363 01752360364 01752360365 01752360365 01752360366)
+44 01752360327 reviews
Add your opinion about +441752360327
UK 1752360327
01603 uk
Who called from number 1752360327
You can rate other simmilar phone numbers from Plymouth, searched in our database
| 1752313990 | 1752366752 | 1752365491 |
| 1752586460 | 1752136151 | 1752295151 |
Random searched phone numbers
| 175 813 8755 | 153 814 468 | 690 144 7157 |
| 204 993 4542 | 990 834 0579 | 520 463 0149 |
Top rated phone numbers
2086698943 SCAM SPAM8081745320 Courier
2151215115 Phone pest scammers who barely speak English Phone straight down
33146003134 SCAM Pertained to be the bank informing me of fraudulent transactions from my account
9418969258 Positive number
1455290007 Nuneaton
2896245300 Thank you Google I almost got scammed from 289-624-5300 289-624-4285 647-354-2063 I was about to call this person for a list of software programs that I wanted for my home and new business office and I noticed that this seller was in Toronto Yes So I was happy about what he had to sell because I wanted these programsand my 14 year daughter said she had a bad feeling about this software guy However my daughter kept begging me and bugging me to Google search this number - 289-624-3
7568060656 Hounslow
7802794588 Automated call
2032907040 planet hub ltd belfast northern ireland
7850190756 carols creations peebles scottish borders
1384099761 Scam about being in a car accident
7788250476 SPAM
7535464464 Wirral
7725982478 Indian accent Microsoft scam Block Gave them mouthful hung up and before i could block them they called back to admonish me for swearing at them hahahahaha
7706787269 Northampton
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
3451242424 Dangerous
1482489786 Do NOT answer or call back very rude and abrupt on the call trying to sell you all sorts of rubbish
1340075645 Rang in the afternoon no answer unable to ring back number doesn039t exist A SCAM
7865499997 bablu uddin london london
7939528645 sudbury
1234067791 Automated message saying I had been involved in an accident
7703345632 great northern property cheadle cheshire
798310244 Maidstone
7468485155 Glasgow
7729189557 West Ealing
1614648486 Sales call re Windows
1952506828 riskbook ltd telford shropshire
7884266566 10
Number popularity chart 1752360327
Your opinion about telephone number 1752360327 (175 236 0327)
Phone Number Lookup By Address: Called Plymouth ??? Your information about who called from number 01752360327 to you will be stored in our database of landline and mobile numbers. Sharingmessage with other users can prevent many threats or form positive feedback on subject of a given telephone or company number. Warning of others about the risks of receiving dangerous and paid phone calls is now an important piece of information that you can use protect against fraud or extortion resulting from high telecommunications fees among others for calling back, writing an SMS, answering a telephone. Maybe somebody called on a loan or a loan, payday or on third party insurance or flat insurance. Someone could also call from a bank or debt collection. 01603 uk. Someone could have contacted the hotel regarding a vacation or holiday, from a service company regarding the service ordered, or called a courier with a parcel to be delivered purchased on the allegro or online store. From what network he called to me?
Possible number records of 01752360327 01752-360-327
+441752360327 |
00441752360327 |
1752 360 327 |
17 52 36 032 7 |
175 23 60 32 7 |
17-52-36-032 7 |
0044 1752-360-327 |
00 44 175 23 60 327 |
(+44)1752360327 |
17 52 36 032 7 |
(17) 5236 032 7 |
00 44 (17)5 23-60-32-7 |
+441752360327 In words... 175 236 0327
one seven five two three six zero three two |
seventeen fifty two thirty six three twenty seven |
Possible number records of 1752360327
Last rated phone numbers
7957699032, 2035142374, 7424920949, 1223748197, 1204806930, 2045244253, 1484315394, 1473241095, 800773878, 2045867078, 63366, 7359861807, 2037697922, 1618186041, 353851959582, 353852401057, 353851968476, 353851943540, 353876707314, 2033181936, 7727425284, 7446976902, 2087871412, 2038621949, 3303413407, 7940490700, 2038687170, 7462702574, 7462702574, 1416736059, 1227915331, 7830302193, 7472127533, 2382622057, 2039051243, 2045384813, 7498540186, 7588518777, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2920084671, 1916597961, 420414529983, 7893914507, 2045765114,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985039862
- Pageviews today : 497872
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1752360327
+441752360327
SCAM A text message from "three" about cutting off my services and asking me to log on with a link. Never had an account with three
Missed call
Call from O2, offering %40 off recent contract
Automated recording trying to sell PPI mis-selling claim service, even though phone number is registered with TPS
website nottingham nottinghamshire
This number claims to be from EON and tells you that your electricity contract is about to expire. it's a SCAM
cold call from Total Debt Relief man called Chris Allen
A guy with an Indian accent called from this number, wanting to sell me an iPhone...but then he tried to have phone sex with me. I'm a guy, by the way. He wanted me to suck his dick, wanted to fuck me...I think the call only ended because his supervisor intervened. I swear, these call centre guys are a bunch of pervs!
Silent call
IT'S A DANGEROUS SCAM! A computer is dialling numbers in sequence to sniff out voice lines. If you speak then the line is detected as 'an active voice line' and logged as such, a scammer will then be calling you later! If you don't recognize the number calling DON'T SPEAK, JUST LISTEN! If you don't hear a voice and then the line goes dead then congratulations - you have just successfully escaped being scammed! THESE CALLS ARE HARASSING AND ALWAYS POTENTIALLY DANGEROUS!
Got a text from that number at 14:28 today stating: "Hey mum I've smashed my phone, please message me on this number 447706598765 urgently x I'm texting of a friends phone". I checked with my child and they said they never contacted me, therefore this must be a scam.
A nuisance call, hung up
Had a call from this number, usual PPI refund.
SCAM Recorded voice message saying £600 been transacted on Nat west visa. Press button to confirm or stop the transaction. Obviously another scam
Missed calls, called back to automic machine, stella UK, tprobably sold by Vanquis bank. Do not answer or give information. PUT THEM ON HOLD BY PLAYING LOUD ROCK MUSIC DOWN THE PHONE!!! :D :D
Telford
London
Someone pretending to be HMRC when called back - I wouldn't call if I was you !!
Private number
Keston
surbiton
Fraud
Well, as per usual, I had a guess it was going to be a waste of time, so I did not answer, as it happens, when I came on here, I assume that I was right! Thank you Tellows for helping us stay on top of these timewasting callers!
Been scammed took money I never got the loan
01752263260
Don't know this number
Private number
Safe number
PPI call. Have had 8 or 9 missed calls - very persistant and pushy. Had to ask several tumes for them to remove me from their lists.
my fairy godmother ipswich sfk
I got this call this morning but no idea who it was they hung up after I said hello
SCAM no answer or reply when you answer phone. its a EE network number some where in Manchester, information from WHO CALLED ME site.
Didnt speak when spoken too, hanged up
keith tomlinson horley surrey
SCAM Pre record Claims to be the NCA and about national insurance number.. Scam..
Bank/Lonas
Leeds
Wolverhampton
Automated message saying I had been involved in an accident
Bank/Lonas
SCAM
Scam
Silence when answered
The caller was cut off
Rang enquiring about myself being involved in an accident that wasnt my fault, blocked
pro production services ltd church crookham fleet ham
Told me that my national insurance number will be suspended due to fraudulent activity. Its a SCAM
SPAM
Rochdale
Male with an Indian accent and poor mumbling speech saying that my postcode has been chosen for a special discount card with all kinds of wonderful offers relating to travel and...
London
Derry
Yes I to had a call from some sort of accident help line, I actually opted in for the call so I could tell them to stop ringing then when I told them I'd never had accident...
SCAM/FRAUD etc A " claims department " - must be about my non -existent claim!!
stampit.ownit ltd rotherham yorkshire
Ignored this caller, as I don't know anyone in Northern Ireland.
SCAM / SPAM Robo call claiming to be HMRC fraud office
When I answered the caller could be heard in the background not speaking. After around 3 secs the caller hung up. Very strange.
Positive number
Northwich
credit card processing terminals. Has a rep in the area to sell you there terminals.
07074632561 Amazon prime renewal scam
Phone pest scammers, who barely speak English ! Phone straight down !
London
Phone scam wanting to transfer money for goods and arrange collection
fed up blocking this number
Attempted to call back but rings once then automatically hangs up? Not sure who or what it was about?
SPAM
Braintree
maidstone
SCAM
Scam call - we are going to cut off your internet.
London
Fraud
junk call. wanted me to get involved in an accident i don t even know about
Thaxted
SPAM
site testing services ltd altrincham altrincham
SCAM
Phoned me 9 times over a 3 day period, when I picked the number up, an aggressive Pakistani man said I d had an accident and told me someone was suing me for hitting their car, I told him not to call, and he used the term F**k off to me then put the phone down, but within the hour he had called again twice. I proceeded to say I would report him to the Police, he shouted something at me and put the phone down again, I had a further 4 calls in the coming days, each week averaging 12 calls.
Just received call from this number. Didn t answer and no message left. I rang 1471 and obtained number and rang it three times and it was a dead line.
Called pretending to be from HMRC and threatening arrest due to outstanding tax bill (which I don t have)
Silent call
boston
Private number
Coventry
SCAM Person wanted to talk to me about Amazon shares. I told them that I do not hold any of those products and she hung up.
Missed call
as above several missed calls, goggled and found above
This number I believe belongs to a double glazing window sales company - Safe Style UK or Instyle UK.
Some nonsense about a survey to find out if I was owed PPI money etc
Fraud Weird call. Not even sure what they wanted. Heavy breathing made it hard to hear.
mr milas london na
max priddy birmingham
ashforce limited chadwell heath essex
Port Talbot
Thankyou, I had not recorded the fact that I had dialled this number, I shall now keep it for future reference.
SCAM / SPAM Mobile message purporting to be from HMRC with a rebate.
Keep getting calls from this number and then the silent treatment 4-5 times a day driving me insane grrrr
SCAM