1908254604 (01908254604)
Who called me from phone number 1908254604 Milton Keynes
Who called me from 1908254604
Phone number 1908254604 it's a landline number from Milton Keynes. This phone number has been searched 1 times. The first search was on 2026-02-16 10:50:22 and the last on 2026-02-16 11:51:22. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1908254604 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441908
Phone number 1908254604 - 0 opinions
Reviews for phone number 1908254604
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1908254604
QR Codes for number +44 1908254604




Phone number 1908254604 (+441908254604)
Country: United Kingdom
Country code: +44 (0044)
City: Milton Keynes
Directional local: 1908 (01908)
Code: 441908 (00441908)
This number was searched 1 times
First date of search: 2026-02-16 10:50:22
Date of last check of this number: 2026-02-16 11:51:22
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 064528091
A similar number: 190825784, 190825681, 190825798, 190825121, 191625460, 191625460, 191725460, 199825460(19 08 25 784,19 08 25 681,19 08 25 798,19 08 25 121,19 16 25 460,19 16 25 460,19 17 25 460,19 98 25 460)
Previous phone numbers: 1908254603 1908254602 1908254601 1908254600 1908254599 1908254598 1908254597 1908254596 1908254595 1908254594 1908254593 1908254592 1908254591 1908254590 1908254589 1908254588 1908254587 1908254586 1908254585 1908254584 1908254583 1908254582 1908254581 1908254580 1908254579 1908254578 1908254577 1908254576 1908254575 1908254574 1908254573 1908254572 1908254571 1908254570 1908254569 1908254568 1908254567 1908254566 1908254565 1908254564 1908254563 1908254562 1908254561 1908254560 1908254559 1908254558 1908254557 1908254556 1908254555 1908254554 1908254553 1908254552 1908254551 1908254550 1908254549 1908254548 1908254547 1908254546 1908254545 1908254544 1908254543 1908254542 1908254541 1908254540
Next phone numbers: 1908254605 1908254606 1908254607 1908254608 1908254609 1908254610 1908254611 1908254612 1908254613 1908254614 1908254615 1908254616 1908254617 1908254618 1908254619 1908254620 1908254621 1908254622 1908254623 1908254624 1908254625 1908254626 1908254627 1908254628 1908254629 1908254630 1908254631 1908254632 1908254632 1908254633 1908254634 1908254635 1908254636 1908254637 1908254638 1908254639 1908254640 1908254641 1908254642 1908254643 1908254644 1908254645 1908254646 1908254647 1908254648 1908254649 1908254650 1908254651 1908254652 1908254653 1908254654 1908254655 1908254656 1908254657 1908254658 1908254659 1908254660 1908254661 1908254662 1908254663 1908254664 1908254665 1908254666 1908254667 1908254668 1908254669 1908254670 1908254671 1908254673 1908254673 1908254674
(Previous phone numbers: 01908254603 01908254602 01908254601 01908254600 01908254599 01908254598 01908254597 01908254596 01908254595 01908254594 01908254593 01908254592 01908254591 01908254590 01908254589 01908254588 01908254587 01908254586 01908254585 01908254584 01908254583 01908254582 01908254581 01908254580 01908254579 01908254578 01908254577 01908254576 01908254575 01908254574 01908254573 01908254572 01908254571 01908254570 01908254569 01908254568 01908254567 01908254566 01908254565 01908254564 01908254563
Next phone numbers: 01908254605 01908254606 01908254607 01908254608 01908254609 01908254610 01908254611 01908254612 01908254613 01908254614 01908254615 01908254616 01908254617 01908254618 01908254619 01908254620 01908254621 01908254622 01908254623 01908254624 01908254625 01908254626 01908254627 01908254628 01908254629 01908254630 01908254631 01908254632 01908254632 01908254633 01908254634 01908254635 01908254636 01908254637 01908254638 01908254639 01908254640 01908254641 01908254642 01908254642 01908254643)
+44 01908254604 reviews
Add your opinion about +441908254604
UK 1908254604
cell phone and mobile phone
Who called from number 1908254604
You can rate other simmilar phone numbers from Milton Keynes, searched in our database
| 1908282480 | 1908272720 | 1908228275 |
| 1908245595 | 1908736387 | 1908959456 |
Random searched phone numbers
| 865 502 7625 | 183 092 2725 | 988 853 787 |
| 825 880 852 | 882 101 3133 | 938 530 0285 |
Top rated phone numbers
7495760826 SPAM1217125431 Automat
8452410473 London
7768160389 Bristol
1484863114 Received a phone call from Tony indianI am ringing aboutwindows on your pc my reply eff off I dont want double glazing on my PC I knew all about their scam
2033225171 SCAM
2086934534 Fraud REPETITIVE CALLS re ampquotBOILER INSURANCEampquot An absolute scam
7768358950 When answered line went dead after a few seconds Tried calling back and goes straight to answerphone Unknown if legit
967733313619 welcome We are pleased to inform you that the cost of tracking the traffic of WhatsApp data No 967733313619 and the details of the phones used to operate it with tracking and opening a loophole for the operator of the phone number 016579991968 as a fake number 52 US dollars we will open a loophole as soon as we receive a notification to pay the amount to the account ABAN AL61190430023457891 Happy to serve you
2074864563 SCAMClaim a Criminal Case has happened in your name police have a warrant to arrest you to immediately stop this warrant press 1 and immediately pay 100
1202918486 Holton Heath Trading Park Poole
160489 160489 sika
1420479225 earthly orbit communications ltd crabtree lane headley hants
1617680128 Manchester
1224044649 SCAM Received a call apparently from O2 asking if my phone service was good I said it was fine and hung up Almost immediately after I received a warning from O2 by text SECURITY WARNING The one-time code you requested will arrive shortly If someones calling you and asking for a code please end the call because they DO NOT work for O2 If you suspect fraud call us on 202 so we can protect your accountSoon after a code came from O2 This suggests the caller was trying to access my account
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1618144920 Called twice today does not leave message Pretty annoying
7771825697 Fraudulent automated call pretending to be from Visa saying that there is a 900 debit pending on my card
2037699916 Fraud
7480024410 National Debt
1932332277 SCAM SPAMReceived call from this number claiming to be from Sky technical services Told them to go away as I am not even a sky customer
7861500697 jf and co limited london guildford
2083940781 SCAM Tax evasion arrest warrant
1484689812 website holmfirth west yorkshire
7538229269 website winkleigh devon
7770441984 Fraud
1614646172 Full info on how to sue spammers here httpsspamcompensationwordpresscomIt is against the law for anyone to electronically send you marketing message unless you have previously given them permissionSending unsolicited text messages is acting contrary to the Data Protection Act 1998 and the Privacy and Electronic Communications Regulations 2003Section 13 of Data Protection Act 1998 and section 30 of Privacy and Electronic Communications Regulations 2003 enable consumers to bring proceeding
1622238608 Caller said they werer a car insurance company calling abut a claime i madde against my vehicleI dont own a carcaller quickly hung up
1217327495 Never heard of Nexbridge Until I Google d them They don t speak nothingthe line just stays Quiet They will phone you 3 or 4 times a day and it s always the same No one speaks
2081613600 The overall rating for phone number 02081613600 is Dangerous
Number popularity chart 1908254604
Your opinion about telephone number 1908254604 (190 825 4604)
Phone Number: Who called now from Milton Keynes ??? If you don't know who called you, you you shouldn't call back to this this phone number. Stay safe and Use our phone number feedback service. Check reviews and phone number ranking add your own review and instruct others if they should answer this incoming call. If you know which company or service called from this phone number, please inform others so that they can get information on our website. If you think this number might be dangerous please review the opinions of other internet users. If you can't call back this phone number is unknown to you. Try to check the opinions about this number first. Who can call. If you are not sure who is calling you from an unknown number First check this number and then you can either call back or wait as he call again. Cell phone and mobile phone.
Possible number records of 01908254604 01908-254-604
+441908254604 |
00441908254604 |
1908 254 604 |
19 08 25 460 4 |
190 82 54 60 4 |
19-08-25-460 4 |
0044 1908-254-604 |
00 44 190 82 54 604 |
(+44)1908254604 |
19 08 25 460 4 |
(19) 0825 460 4 |
00 44 (19)0 82-54-60-4 |
+441908254604 In words... 190 825 4604
one thousand nine hundred eight two hundred fifty four six hundred four |
one billion nine hundred eight million two hundred fifty four thousand six hundred four |
Possible number records of 1908254604
Last rated phone numbers
7934686266, 2039917613, 2034754766, 2045711197, 2382622037, 2038179694, 1204375295, 7441410718, 7441410718, 1702418530, 7436367055, 7984380427, 7435705358, 64057, 2035198029, 2035198029, 7379861792, 1313811478, 7441913149, 1372736232, 1173259164, 7456207537, 7487256090, 1357333025, 2038465513, 7359303633, 2076341535, 63366, 7458148209, 1915800092, 7715623848, 7907413017, 2038891669, 2031502547, 7931412456, 1908103106, 1997362534, 1135349294, 1243581118, 2080626791, 7359572537, 3316301485, 7700199390, 7418601778, 1614644147, 7755212697, 7970256975, 7561096311, 2036215808, 7359277300,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13304
- Users online : 174
- Bots online : 13130
- Google Bots : 1
- Unique users : 140
- Unique bots : 443
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985158762
- Pageviews today : 616772
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1908254604
+441908254604
SCAM
SCAM Claimed to be Lloyds saying I had an attempted payment to MR A JONES
Private number
Fraud Claiming to be HMRC saying you will be arrested for non payment of a tax fraud
Services
This number is not recognised when dialed, believe it s a scam call
martin hand gloucester gloucestershire
Insulation
SCAM
As I am on call preference no company should be cold calling me
Just curious
This number 07053523025 is a scam number that charges ridiculous amounts while they keep you on hold for a manager. A 40 minute wait for a manager will cost you at least 35 pounds.....Outright scam. Avoid completely.
Seems to be the well known loft insulation scam.
1231430048
Said they were from Pro-Alliance and that I’d been involved in an accident that wasn’t my fault.
Silent call
London
Fraud threats claiming to be from national insurance department
Obnoxious female called asking for my husband and when I said he was not here she said the landlord had called them about a boiler fault. I explained it was not a rented house ...
Bolton
Telling to tell me I have a warrant out for my arrest when I haven’t done anything
Pretend to be BT engineer service, want to access and control your computer, be very aware.
Positive number
Safe number
Castle Donington
Positive number
medichem international limited sevenoaks kent
Rang my mobile at 2.45pm, only rang a couple of times before cutting off. Not a number I know and I'm not expecting anyone from Berwick - on - Tweed in Scotland to call me!
ULCEBY
Bolton
this is a payday express number. they have over 50 as they pretend to be located in different area codes to make you pick up the phone. i will go through and add comments on all...
SCAM
Bristol
LONDON
Didn't know what it was but after reading this I think it might be PPI
Telemarketing
D C Thomson, publishers, Dundee.
basa direct aberystwyth
Services
peter muswell-cityfringe.com london
Caller just says 'good bye'. Possibly testing if line is active, very annoying!
SCAM
Called to confirm domain. Legit and all good :)
Call from Leicester, woman enquiringly about an accident I'd had. Totally untrue, realised it Was dodgy so hung up.
SCAM
SCAM Loft Insulation scam
softwre solutions ltd london uk
medical resourcing agency
Silent caller. Line dropped after about 30 seconds.
Courier
Homebase Orbital
Was suspicious so didn't answer.
This number called 3 times last week, but no message ever left. Suspicious.
SPAM
james forshaw london london
Government- fraudulent use of NI Number, asks you to call back before you are arrested!
Scam
Fraud
Services
physio2fit southampton hampshire
SCAM Received a phishing text from this number, pretending to be my bank. I called Lloyds who confirmed it is a scam. Number now blocked.
Chichester
Wickford
Fraud
Comes up as a Quebec number
Scam PPI text claiming they have detals of my claim and want to send a claim pack. I ve never had PPI!
Called and left no voice mail
Missed call. The caller left a voicemail, but unfortunately it was totally muffled/garbled, so I was not able to understand a single word of it. My being hard-of-hearing didn't help!
SWINDON
Peacehaven
Sending whatsapp messages with personal information asking to confirm
One number too short to be Australian. Possible callback fraud
I receive a phone call every morning from this number and when I answer they hang up. Very frustrating.
Rochester
lovin your work sister bath bath and north east somerset
joseph sopher letchmore heath herts
I think this is a scam. Told that a transfer of a large sum of money was blocked ... scary bit was the value of the money was a value I do transfer.
Fraud
Fraud
Repeatedly called after rejecting, unsure what it was about as the line wasn't great.
رقم مين
Don't know who this is, they did not leave a message, I rang it because I have business in wales yet I was on hold for 5 mins with no answer and no explanation to who they...
London
Phone call saying they were taking £79.99 from my account, press this number for more information. Stated the company as AVALON
I keep getting niusance calls from this number throughout the day. It is online insurance bureau, they call and speak about loans and personal insurance. waste of time
blocked it straight away.
claimed to be HMRC and a tax fraud case registered under my name. nclearly a spam. Potentially very dangerous in my opinion
sarah marshall halesowen west midlands
SPAM: Chinese automated message
Scam msg from 60693 Hey Astrid, you can replace your old phone for a brand new one: 8uy.me/hpcnH
The overall rating for phone number 25715949013 is Dangerous
Debt collector ARC
London
hills plc west midlands
Private number
الإنترنت
Brighton
Newcastle Upon Tyne
One of many scam numbers now doing the rounds. DON'T CALL BACK. IT WILL COST YOU MONEY!!!!
What can I say? It was a silent call.