1908351269 (01908351269)
Who called me from phone number 1908351269 Milton Keynes
Who called me from 1908351269
Phone number 1908351269 it's a landline number from Milton Keynes. This phone number has been searched 1 times. The first search was on 2026-02-16 10:52:13 and the last on 2026-02-16 11:53:13. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1908351269 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441908
Phone number 1908351269 - 0 opinions
Reviews for phone number 1908351269
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1908351269
QR Codes for number +44 1908351269




Phone number 1908351269 (+441908351269)
Country: United Kingdom
Country code: +44 (0044)
City: Milton Keynes
Directional local: 1908 (01908)
Code: 441908 (00441908)
This number was searched 1 times
First date of search: 2026-02-16 10:52:13
Date of last check of this number: 2026-02-16 11:53:13
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 621538091
A similar number: 190835718, 190835219, 19083510, 190835624, 195335126, 195335126, 196635126, 196035126(19 08 35 718,19 08 35 219,19 08 35 10,19 08 35 624,19 53 35 126,19 53 35 126,19 66 35 126,19 60 35 126)
Previous phone numbers: 1908351268 1908351267 1908351266 1908351265 1908351264 1908351263 1908351262 1908351261 1908351260 1908351259 1908351258 1908351257 1908351256 1908351255 1908351254 1908351253 1908351252 1908351251 1908351250 1908351249 1908351248 1908351247 1908351246 1908351245 1908351244 1908351243 1908351242 1908351241 1908351240 1908351239 1908351238 1908351237 1908351236 1908351235 1908351234 1908351233 1908351232 1908351231 1908351230 1908351229 1908351228 1908351227 1908351226 1908351225 1908351224 1908351223 1908351222 1908351221 1908351220 1908351219 1908351218 1908351217 1908351216 1908351215 1908351214 1908351213 1908351212 1908351211 1908351210 1908351209 1908351208 1908351207 1908351206 1908351205
Next phone numbers: 1908351270 1908351271 1908351272 1908351273 1908351274 1908351275 1908351276 1908351277 1908351278 1908351279 1908351280 1908351281 1908351282 1908351283 1908351284 1908351285 1908351286 1908351287 1908351288 1908351289 1908351290 1908351291 1908351292 1908351293 1908351294 1908351295 1908351296 1908351297 1908351297 1908351298 1908351299 1908351300 1908351301 1908351302 1908351303 1908351304 1908351305 1908351306 1908351307 1908351308 1908351309 1908351310 1908351311 1908351312 1908351313 1908351314 1908351315 1908351316 1908351317 1908351318 1908351319 1908351320 1908351321 1908351322 1908351323 1908351324 1908351325 1908351326 1908351327 1908351328 1908351329 1908351330 1908351331 1908351332 1908351333 1908351334 1908351335 1908351336 1908351338 1908351338 1908351339
(Previous phone numbers: 01908351268 01908351267 01908351266 01908351265 01908351264 01908351263 01908351262 01908351261 01908351260 01908351259 01908351258 01908351257 01908351256 01908351255 01908351254 01908351253 01908351252 01908351251 01908351250 01908351249 01908351248 01908351247 01908351246 01908351245 01908351244 01908351243 01908351242 01908351241 01908351240 01908351239 01908351238 01908351237 01908351236 01908351235 01908351234 01908351233 01908351232 01908351231 01908351230 01908351229 01908351228
Next phone numbers: 01908351270 01908351271 01908351272 01908351273 01908351274 01908351275 01908351276 01908351277 01908351278 01908351279 01908351280 01908351281 01908351282 01908351283 01908351284 01908351285 01908351286 01908351287 01908351288 01908351289 01908351290 01908351291 01908351292 01908351293 01908351294 01908351295 01908351296 01908351297 01908351297 01908351298 01908351299 01908351300 01908351301 01908351302 01908351303 01908351304 01908351305 01908351306 01908351307 01908351307 01908351308)
+44 01908351269 reviews
Add your opinion about +441908351269
UK 1908351269
phone directory lookup
Who called from number 1908351269
You can rate other simmilar phone numbers from Milton Keynes, searched in our database
| 1908342562 | 1908382093 | 1908325619 |
| 1908683528 | 1908798401 | 1908418639 |
Random searched phone numbers
| 963 574 5693 | 425 478 7572 | 946 729 7133 |
| 814 908 1373 | 647 738 4073 | 534 169 7622 |
Top rated phone numbers
7938655211 Positive number1440857943 SPAM
7780469082 Extremely rude Telemarketing When I asked how they had my number he became very aggressive
8801401940844 017255169
7985666877 SPAM
1612350511 fraud call
2080581698 SCAM
4101479298 Yet another call from American accented woman telling me Amazon Prime was about to be cancelled
7851346145 Southampton
7927171211 SCAM
7398249754 YARM
7748814014 SCAM
1625410950 belvoir macclesfield n a
7966406501 christopher warwick wigan lancashire
1241453004 The overall rating for phone number 01241453004 is Dangerous
2083080757 Rang off when I answered phone One of many such calls in recent weeks Someone must have recently sold a list of UK phone numbers I am just thankful that I do not have to s
9742430692 Telemarketing
2083965323 Glasgow
1204919546 SCAM
7404561745 Missed call
1582609977 Another call centre calling a TPS registered private number and not even leaving a telephone message Who are these people and why is the TPS not prosecuting and closing them
1216550177 Company called true hrd advice obvious scam AVOID
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1217050650 Shirley
1628861503 This caller is from a company called Whistle a comprehensive postal solution company I spoke to a sales person going by the name of Jake Pollyblank well manered not pushy o
8452410473 London
2039421611 didnt answer - had spate of calls from similar numbers
2089390060 page turn interactive richmond sry
8000773355 A woman on the other line asked for my mortgage i told her that i dont have one because im just a hirer then she hung up strange
1343542264 MORAYSHIRE
Number popularity chart 1908351269
Your opinion about telephone number 1908351269 (190 835 1269)
Telephone Number Lookup: Called Milton Keynes ( 01908351269) Stay safe through our website with opinions about mobile and landline numbers. Check and add your own opinions about the unknown number you are currently browsing Share with others your experience who called from this phone number. This is very necessary for other users who will check this phone number in the future. Maybe you will someday check this phone number again so our site will serve as a storage space or a base for your opinions and opinions of other users in one place. If you don't know who called you from this unknown phone number, first check this number in our number database. It may be a positive number, but it may turn out that this number is a negative number that causes fees or that Phishing personal data. Phone directory lookup. Perhaps this is the number of an advertising agency or marketing company that wants to offer you unwanted services. Maybe this is a call center that I am trying to reach you in connection with a case in an office or bank or other company. Invite others to use this site to add feedback about unknown phone numbers.
Possible number records of 01908351269 01908-351-269
+441908351269 |
00441908351269 |
1908 351 269 |
19 08 35 126 9 |
190 83 51 26 9 |
19-08-35-126 9 |
0044 1908-351-269 |
00 44 190 83 51 269 |
(+44)1908351269 |
19 08 35 126 9 |
(19) 0835 126 9 |
00 44 (19)0 83-51-26-9 |
+441908351269 In words... 190 835 1269
one thousand nine hundred eight three hundred fifty one two hundred sixty nine |
one nine zero eight three five one two six |
Possible number records of 1908351269
Last rated phone numbers
1539716036, 1939834047, 2035142146, 1234385592, 1939834876, 1962896931, 1962896920, 7551284874, 1912824788, 7926361076, 7974702850, 7591379590, 1273476754, 1883901019, 918422057868, 919674461881, 7425020896, 7359589459, 1873440556, 7742451836, 2081433067, 7440792341, 2086700200, 7880899509, 7701407100, 2080544778, 7480421187, 7482439161, 1515283062, 1787201908, 1482293786, 1793370992, 7500089603, 1902943377, 1142689980, 2034673641, 7753380363, 7978299703, 7537416300, 7820654673, 7538929990, 7456953277, 7476021807, 7487353774, 7487353774, 1902943972, 7480258922, 2045200399, 1163502892, 1969622775,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13304
- Users online : 174
- Bots online : 13130
- Google Bots : 1
- Unique users : 140
- Unique bots : 443
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985160407
- Pageviews today : 618417
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1908351269
+441908351269
Broad band scammer. Has a dangerous auto call back.
Scam
Curious.keeps ringing me
Keeps calling at the weekend, won t leave a message. Annoying. If it is Laithewaites I am already a customer!
extremely annoying
Indian accent, saying they are from BT technical department. We are not a BT customer. When asked who they want to talk to they hang up. They have called about 10 times in the p...
Newtown
SCAM
National insurance fraud call
Halifax
Who is Tim Buk???? I keep getting calls from this number but no one speaks@ so annoying! 01502 730214
Mytchett
Had a call from a foreign sounding gentleman claiming to be from North Yorkshire County Council asking about an accident that I may have had. As a local Parish Councillor I know...
SCAM
They called me today asking for my wife, said they had details of a loan she d taken out that had been passed on to them, I pressed for details and they gave some details of a loan she hasn t taken out. She said the company was BPI Claim Line and are part of another company (couldn t make out the name) and they re regulated by the Ministry of Justice. She hung up on me when I pressed her for the company name that they were part of.
PORTSMOUTH
Safe number - Howdens Credit Control
Courier
Silent call
Wolverhampton
SCAM
Bedfordshire
early birds nursery bude ex23 8rj
Bring it back, sing it back, bring it back to me~
Rang and went to automated message with options to go to this and that. Poor connection but seemed similar to the HMRC scam call a while ago.
Cabot Financial calling constantly, trying to collect on a debt.
northumberland
Third time in three days. nThey hang up if you say nothing. nIf you say Hello and "How can I help you" a woman with an Asian voice responds. nWe are signed up to the c...
lucien wynn exmouth exmouth
This number rings me twice a day but my phone doesn t actually ring - very annoying - how do I block this call
I keep getting calls from this number. I do not know it and I would like to know who it is please.
Government- fraudulent use of NI Number, asks you to call back before you are arrested!
Told me that i had been in an accident that wasn't my fault
Crawley
No one there called back and no answer prob scam have reported number
SCAM Fortunately, I have TruCaller home phone so pushed it straight to the "waiting" queue and as they didn't leave a message or say who was calling did not route through to the actaual phone ring. I already had this number blocked on my Mobile and in Malwarebytes as it claimed to be from BT saying there was a problem with my broadband... when I mentioned that I worked for BT as a fault engineer they immediately hung up :)
tossers get a real job or does samming make more than real job?
Obvious scam, claiming to be from EE retaining department. If you google the number it comes up as a Noodle bar in London. The guy on the call couldn't stop stumbling over his words when I called him out on things and then laughed at me when I said I knew it was a scam.
SCAM
the phonecessories company stanmore
Man with Scottish accent spoke to ask how I was, then I asked 'Who are you?' and he hung up!
SCAM Automated fake call from HMRC threatening legal action, annoying and definitely not legitimate!
Phishing. Very annoying. Contacted and reported HMR. Don’t answer and block that number.
Bank/Lonas
Royal Mail shipping Scam, block this caller 07508786159
SCAM
the medical frigate charitable incorporated organisation huddersfield n a
Called to confirm domain. Legit and all good :)
I refused to pick this call as it is a U.S. number and I am in the UK.
SCAM / SPAM Transaction of £600 made to foreign country half an hour ago. Automated call but doesn't say which bank - just to press 3 to talk to someone from your card provider. DO NOT RESPOND.
anthony light eastbourne eastbourne
Hack
Fraud,, a pre recorded message saying they’re from the Tax man
Melrose
overseas call didn t answer
SCAM claiming to be from paypal, stating click link.
Friendly number
dilan koca london
I believe it's PPI. They have started to vary the numbers, but the dialing code is always a local one, so you think it's possibly someone you know.
Didn't answer as number not known, they hung up after the initial "hello" on the answerphone. Now blocked
I got a call from this number twice today at 09.30 & 10.55 I don't answer if I don't recognise it, these 020's are calling everyday 5 or 6 times a day, it...
SPAM
Retford
Number vaguely familiar but with no identification unable to be more positive. Leaving it at neutral for the time being.
SPAM
Robot telling me I have committed tax fraud
paradigm creative ltd huddersfield
Completely fed up with these calls, why they keep calling because I never answer, if they are calling regarding PPI, am not likely to be in for a refund, as I have never borrowed money in my life can t afford it do without.
Almost simultaneous random calls from 01183040465 and 07435560065. Did not answer either.
London
A woman on the other line asked for my mortgage. i told her that i dont have one because im just a hirer. then she hung up. strange!
SCAM Insurance scam... tell them about your accident and they will get extra money for you from the third party insurance... Pushy and called from two different numbers... I hung up on first and they called from different location. Claim they are registered, but the compnay was dissolved in 2021, could not provdie website or further ifformation about when they compnay was set up.
Glasgow
Complete load of rubbish and scam. Blocked.
SCAM- claiming to be hmrc saying there's a problem with tax
Keeps calling phone automatically silences as spam
Services
Unilever ice creams telephone account manager. called to arrange appointment with me and sort out all of my advertising for products this year. also keeps me up to date with cha...
Telling me hes from bt and im having a problem with my broadband, i dont have broadband with bt, barred
One ring then hung up, so I m presuming it s a cost trap.
This number is now being used by a company calling itself Ownership Release Services. Usual lies about claims for mis-selling of timeshare. This number is also used by Timeshare Solutions Release and Timeshare Release.
centre for holistic and psychological healthcare limited london lnd
Services
Fraud
Chelmsford
r3brand oldbury gb
physio2fit southampton hampshire
SPAM text message from Hermes asking to click a link to pay for a missed delivery
Fraud
Services
SCAM
Poynton
steven symeon blackpool blackpool
Fraud
indexingbase belfast northern ireland
Fraud - robot message. Claims to be a lawsuit against my name will be referred to the county court house if I don't call them back.
Recorded message purporting to be from Amazon. Apparently someone placed an order for an iPhone 12 on my account (the bold- faced cheek of some people, eh?) and somehow Amazon found this to be suspicious (probably because me and Jeff are really big buddies!) and wanted me to address it as they didn't want me to be out of pocket (to anyone other than themselves no doubt!). If I hadn't hung up, they'd have been asking for all kinds of personal detail of my account. But I hung up before they asked.
South Croydon
website kimpton aberdeenshire
The beginning of the story is the same.........tax office,police,court.......etc. nShe told I had to be in an hour in a 30 miles away office to pay,I told I could not....Certain...