1908480496 (01908480496)
Who called me from phone number 1908480496 Milton Keynes
Who called me from 1908480496
Phone number 1908480496 it's a landline number from Milton Keynes. This phone number has been searched 1 times. The first search was on 2026-02-16 10:52:43 and the last on 2026-02-16 11:53:43. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1908480496 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441908
Phone number 1908480496 - 0 opinions
Reviews for phone number 1908480496
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1908480496
QR Codes for number +44 1908480496




Phone number 1908480496 (+441908480496)
Country: United Kingdom
Country code: +44 (0044)
City: Milton Keynes
Directional local: 1908 (01908)
Code: 441908 (00441908)
This number was searched 1 times
First date of search: 2026-02-16 10:52:43
Date of last check of this number: 2026-02-16 11:53:43
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 940848091
A similar number: 190848415, 190848774, 190848879, 190848275, 191348049, 191348049, 192948049, 192048049(19 08 48 415,19 08 48 774,19 08 48 879,19 08 48 275,19 13 48 049,19 13 48 049,19 29 48 049,19 20 48 049)
Previous phone numbers: 1908480495 1908480494 1908480493 1908480492 1908480491 1908480490 1908480489 1908480488 1908480487 1908480486 1908480485 1908480484 1908480483 1908480482 1908480481 1908480480 1908480479 1908480478 1908480477 1908480476 1908480475 1908480474 1908480473 1908480472 1908480471 1908480470 1908480469 1908480468 1908480467 1908480466 1908480465 1908480464 1908480463 1908480462 1908480461 1908480460 1908480459 1908480458 1908480457 1908480456 1908480455 1908480454 1908480453 1908480452 1908480451 1908480450 1908480449 1908480448 1908480447 1908480446 1908480445 1908480444 1908480443 1908480442 1908480441 1908480440 1908480439 1908480438 1908480437 1908480436 1908480435 1908480434 1908480433 1908480432
Next phone numbers: 1908480497 1908480498 1908480499 1908480500 1908480501 1908480502 1908480503 1908480504 1908480505 1908480506 1908480507 1908480508 1908480509 1908480510 1908480511 1908480512 1908480513 1908480514 1908480515 1908480516 1908480517 1908480518 1908480519 1908480520 1908480521 1908480522 1908480523 1908480524 1908480524 1908480525 1908480526 1908480527 1908480528 1908480529 1908480530 1908480531 1908480532 1908480533 1908480534 1908480535 1908480536 1908480537 1908480538 1908480539 1908480540 1908480541 1908480542 1908480543 1908480544 1908480545 1908480546 1908480547 1908480548 1908480549 1908480550 1908480551 1908480552 1908480553 1908480554 1908480555 1908480556 1908480557 1908480558 1908480559 1908480560 1908480561 1908480562 1908480563 1908480565 1908480565 1908480566
(Previous phone numbers: 01908480495 01908480494 01908480493 01908480492 01908480491 01908480490 01908480489 01908480488 01908480487 01908480486 01908480485 01908480484 01908480483 01908480482 01908480481 01908480480 01908480479 01908480478 01908480477 01908480476 01908480475 01908480474 01908480473 01908480472 01908480471 01908480470 01908480469 01908480468 01908480467 01908480466 01908480465 01908480464 01908480463 01908480462 01908480461 01908480460 01908480459 01908480458 01908480457 01908480456 01908480455
Next phone numbers: 01908480497 01908480498 01908480499 01908480500 01908480501 01908480502 01908480503 01908480504 01908480505 01908480506 01908480507 01908480508 01908480509 01908480510 01908480511 01908480512 01908480513 01908480514 01908480515 01908480516 01908480517 01908480518 01908480519 01908480520 01908480521 01908480522 01908480523 01908480524 01908480524 01908480525 01908480526 01908480527 01908480528 01908480529 01908480530 01908480531 01908480532 01908480533 01908480534 01908480534 01908480535)
+44 01908480496 reviews
Add your opinion about +441908480496
UK 1908480496
find unknown number online
Who called from number 1908480496
You can rate other simmilar phone numbers from Milton Keynes, searched in our database
| 1908419158 | 1908418133 | 1908475512 |
| 1908908284 | 1908337667 | 1908618973 |
Random searched phone numbers
| 932 794 2348 | 142 143 7124 | 585 845 0807 |
| 695 366 3285 | 194 831 5497 | 924 091 4773 |
Top rated phone numbers
7795313864 career iq limited kinross8714088873 SPAM
7812692584 London
2089403907 SPAM Claimed to be technical department of BT rang off when I asked for details
1918488888 Called saying I had a problem with my broadband Assumed scam call
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
7896415909 Romsey
2078909052 I live in Norway and was called up twice in the evening by this number I did not answer because of the fact it was evening and I did not expect anyone from UK to call me on my private mobile phone
1524415947 Didnt answer as number not known they hung up after the initial ampquothelloampquot on the answerphone Now blocked
1332646311 A returned call gives number not in use
7590212647 _ aylesbury bucks
7500860223 Fraud
2036241419 SCAM SPAM claiming to be HMRC and you have committed tax fraud it tells you to press 1 or be arrested with a warrant
7931660874 London
1792689236 get calls when answer no one speaks just noise in backgroundwhen phone back no answer
7424616797 keshav inc uptonpark london
1413270044 Unilever ice creams telephone account manager called to arrange appointment with me and sort out all of my advertising for products this year also keeps me up to date with cha
7834713963 TAXES HMRC
7815991251 SPAM
1513759863 SCAM SPAM
7957496712 Fraud
1217329831 Someone claiming to be from quotTenancy Deposit Helplinequot asking if we have a private tenancy deposit Asked where they got our details from they said from the Tenancy Deposit Scheme I said surely theyd know if we had a private deposit if that was where they got out details He hung up
8456801900 cognesia ltd london
7879207771 SCAM text message for an undelivered Hermes parcel do not click on link to pay a delivery charge
1772623580 Private number
7504618252 Silent call
7866618045 DINGWALL
1932572701 Safe number Delvaux Ltd
1133861095 Fraud
7508786159 Royal Mail shipping Scam block this caller 07508786159
Number popularity chart 1908480496
Your opinion about telephone number 1908480496 (190 848 0496)
Tel Serach: Who called from UK Milton Keynes ??? Who is calling from 01908480496?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Find unknown number online. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 01908480496 01908-480-496
+441908480496 |
00441908480496 |
1908 480 496 |
19 08 48 049 6 |
190 84 80 49 6 |
19-08-48-049 6 |
0044 1908-480-496 |
00 44 190 84 80 496 |
(+44)1908480496 |
19 08 48 049 6 |
(19) 0848 049 6 |
00 44 (19)0 84-80-49-6 |
+441908480496 In words... 190 848 0496
one thousand nine hundred eight four hundred eighty four hundred ninety six |
one nine zero eight four eight zero four nine |
Possible number records of 1908480496
Last rated phone numbers
7359340657, 7359828840, 7942051543, 7368306262, 7359825615, 2922640201, 4917655756277, 212646663105, 2031371870, 7477172814, 2922711579, 7768210969, 1758265326, 7518173234, 19095701903, 1324232041, 7893, 1202933184, 2922641913, 7588685354, 35722032305, 1156610601, 1135127671, 3330459521, 330459561, 1135190879, 8445301538, 353877821258, 7801476318, 7445742398, 63366, 8000113312, 7473168971, 7763449748, 8659732684, 7552273486, 2039365022, 2039365021, 2039365021, 2039365022, 1515561109, 2039365022, 2039365022, 2039365022, 8451340019, 4915172166153, 7479929342, 2039365022, 1782890924, 1143603919,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13304
- Users online : 174
- Bots online : 13130
- Google Bots : 1
- Unique users : 140
- Unique bots : 443
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985160863
- Pageviews today : 618873
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1908480496
+441908480496
If you have recieved a call from this number do you know the name of the caller
SCAM - claims to be Royal Mail holding parcel at depot and needing a fee to release.
continually ringing our land line, when answered no one there. very annoying!!!
Cold Caller from Hearing clinic on 01332340425 called Meena. Works at Hearing Clinic in Derby. Gets our data from the British Data Company How can they be allowed to exist ...
Silent call caller hung up after answering
THIS IS A FRAUDULENT COMPANY DO NOT PART WITH MONEY THEY ARE NOT REGISTERED WITH THE FCA OR COMPANYS HOUSE! THEY ARE LYING! THEY WILL CALL YOU RUDE NAMES WHEN YOU SAY NO!
Fraud. Census fraud. Asks you to follow link on text message saying they haven't received your Census and you will be fined £1000. REALLY....Do they think I'm some sort of smuk... BLOCKED.
Spam
SCAM Recorded Message claiming to be from National Crime Agency about your Nat Insurance. BIG SCAM LEAVE ALONE BLOCK DELEAT.
These guys offer a supposed Nuisance Call Blocker service but the only nuisance calls I get are from these people. They call 5-6 times a day no matter what I do or say.
Bedfordshire
This number is now being used by a company calling itself Ownership Release Services. Usual lies about claims for mis-selling of timeshare. This number is also used by Timeshare Solutions Release and Timeshare Release.
SCAM SCAM from India. Pretending to offer a good phone contract SCAM
acl automotive wimborne dorset
I had 2 calls today from 0161 854 0063. They said they were called infinity (her name was niamh) asking about my life insurance policy.... I know this is a scam as I'm 22, ...
BEWARE ! THIS IS A SCAM TELEPHONE NUMBER DO NOT GIVE OUT YOUR DETAILS CALL ACTIONFRAUD.POLICE.UK 0300 123 2040
Shows up astel number 11440235147253 in my true call device so clearly a scam so reported and blocked
Waited to speak to someone real. Not an answering machine. In an Indian accent he said his name was Dave. I asked him what he was wearing and breathed hard. He hung up. Pity.
Scam
SCAM
SCAM some automated message about legal action. There are so many adds on this whocalledme page I can hardly use it.
Aberdeenshire
Totnes
Cabot Financial calling constantly, trying to collect on a debt.
Fraud Text message saying from HSBC taking £1500 out of my account. To cancel this click on a link!
cosmex clinic cambridge cambridgeshire
SCAM / SPAM I suspect this is not legitimate. Automated call saying my Amazon account was being renewed at £75.99? I ended the call. Anyone have any comments?
A man with a very strong Indian accent called from this number, 02011158441. He said he was from "Windows" and that my computer was causing interference to other user...
screen wizzard beds beds
I was called by a stroppy Welsh woman who wouldn t shut up when I asked her where she got my number from. She came out with some rubbish about me being on a government data base that said I had a credit card - what bloody business it of hers? These people truly are the scum of the earth. cwhat is th e point of me registering with TPS if I keep getting calls from brain dead morons reading from a script. Oh well the last two words she heard from me began with F and O. She was so aggressive!!
SCAM people calling wanting to renew your car's warranty before it runs out, which is a total scam
TAXES / HMRC Robotic voice warning that a Tax fraud case will be opened if I don't press one, and a warrant will be issued for my arrest soon
SPAM
Silent call Missed call
munco international ltd derby derbyshire
Get CPR CallBlocker for less than ?40, it stops pretty well anything; overseas, unavailable, withheld, private & any displayed numbers too. With capacity for over 1000 numbers it s far better than registering with TPS or such useless companies.
SCAM
SCAM
insights2innovate monmouth monmouthshire
Everymorning, same time.says its bt and my phone will be cut off due to fraudulent activity Don't even have bt. Asks.ypu to.press 1.
cedric's plumbing and heating limited london
SCAM - Prerecorded message claiming to be HMRC telling me there was fraud on my account.
matter codnor park ironville nottingham ngm
SCAM / SPAM
Lady called stating I had a recent car accident blah. Asked her how she got my number. She stated they got it from the Road Traffic Accident Claim Department. I said I d never heard of it. Was it a Government department. Long silent pauses at the other end. Repeatedly asked her to spell the name of her company. She rang off. Surprise surprise. Funnily enough I had been speaking to my insurance company (Covea) only 30 mins before asking how these scumbags get my mobile number. They don t know!
Said his name was Chris and he was an advisor, when I said it was a bad line and I couldn't understand him it went silent. He probably wasn't programmed to answer that!!
Called to confirm domain. Legit and all good :)
Silent call nuisance.
They say nothing. Then 'hello' and hung up. Nuisance
Call received from this number 12 March. Recorded message in American accent reporting to be Amazon stating an order had been placed for over £300 and if I hadn t placed it...
SPAM
Bisley
0401491565
Completely fed up with these calls, why they keep calling because I never answer, if they are calling regarding PPI, am not likely to be in for a refund, as I have never borrowed money in my life can t afford it do without.
Claimed to be from the Citizen s Advice Bureau and wanted to help with a supposed debt collection- who would never call people. They knew my name which is concerning. Indian call centre - This is a scam and needs to be stopped!
peter arnott falkirk stirlingshire
Tracing who called me
arandur accounting limited worthing worthing
who called me 01702 311007
Kettering
Fraud - Tells you you're being investigated for Tax Fraud and to press 1 to find out more
lAnother anonymous call.
SCAM
cih solutions ltd. surbiton surrey
edward lewis warwick
one steppe ahead london london
Although number came up as 01689 325137 I missed call message that said the number was 0161 814 9317.
JCT 600 trying to get me to book a service for my VW.
fleming private office ltd maidstone kent
I get a call almost every hour, very annoying!!
Fraud
Services
Fraud
oliver howes pudsey yorkshire
Positive number
kind of background noise but nobodys talking.. and call a couple times later
I answered a call from this number at 2.19pm today and I could not understand what the man on the phone was saying. When I said, Sorry as in I didn't understand and wanted him to repeat what he said, he just hung up. I'm guessing it was some sort of SPAM phone call.
it s akinika - used to be iQor. They collect on government debts but are still bound by OFT (now fca)debt collection guidance.
SPAM
07010731888 called my home phone. I answered and got 20 seconds of silence before they hung up.
Says its from hsbc probably fraudulent
Oxford
Services
bromley hospitals nhs trust bromley bromley
Positive number
Hung up the moment I answered
Missed call
Fraud
e-travelguide reading berkshire
Leicester
Qodirbek
032103513
Calling me every weekday. Ignoring doesn t work so tomorrow I will answer.
Extremely rude. Telemarketing. When I asked how they had my number, he became very aggressive
South Croydon
A call to confirm a competition entry but then started talking about an offer. Guessing not anything genuine. Asked me wouldn't I like to be a millionaire sometime? So I sa...
SCAM.. Tried phoning back, incorrect number dialled message.. Man on end of the phone with a heavy accent wanted to know details about a minor, non fault accident, no accident has occurred, consider this number as a potential scam.
This looks 100% like a local number - but beware - it is NOT. It is a computer voice purporting to be from Amazon to say that I have been charged £399 for a phone, and to press 3 to confirm my details. When will this type of call be stopped??
Another scam amazon call, sick of these morons
Luton