1908993811 (01908993811)
Who called me from phone number 1908993811 Milton Keynes
Who called me from 1908993811
Phone number 1908993811 it's a landline number from Milton Keynes. This phone number has been searched 1 times. The first search was on 2026-02-16 10:53:15 and the last on 2026-02-16 11:54:15. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1908993811 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441908
Phone number 1908993811 - 0 opinions
Reviews for phone number 1908993811
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1908993811
QR Codes for number +44 1908993811




Phone number 1908993811 (+441908993811)
Country: United Kingdom
Country code: +44 (0044)
City: Milton Keynes
Directional local: 1908 (01908)
Code: 441908 (00441908)
This number was searched 1 times
First date of search: 2026-02-16 10:53:15
Date of last check of this number: 2026-02-16 11:54:15
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 183998091
A similar number: 190899629, 190899829, 190899957, 190899446, 196799381, 196799381, 193999381, 199299381(19 08 99 629,19 08 99 829,19 08 99 957,19 08 99 446,19 67 99 381,19 67 99 381,19 39 99 381,19 92 99 381)
Previous phone numbers: 1908993810 1908993809 1908993808 1908993807 1908993806 1908993805 1908993804 1908993803 1908993802 1908993801 1908993800 1908993799 1908993798 1908993797 1908993796 1908993795 1908993794 1908993793 1908993792 1908993791 1908993790 1908993789 1908993788 1908993787 1908993786 1908993785 1908993784 1908993783 1908993782 1908993781 1908993780 1908993779 1908993778 1908993777 1908993776 1908993775 1908993774 1908993773 1908993772 1908993771 1908993770 1908993769 1908993768 1908993767 1908993766 1908993765 1908993764 1908993763 1908993762 1908993761 1908993760 1908993759 1908993758 1908993757 1908993756 1908993755 1908993754 1908993753 1908993752 1908993751 1908993750 1908993749 1908993748 1908993747
Next phone numbers: 1908993812 1908993813 1908993814 1908993815 1908993816 1908993817 1908993818 1908993819 1908993820 1908993821 1908993822 1908993823 1908993824 1908993825 1908993826 1908993827 1908993828 1908993829 1908993830 1908993831 1908993832 1908993833 1908993834 1908993835 1908993836 1908993837 1908993838 1908993839 1908993839 1908993840 1908993841 1908993842 1908993843 1908993844 1908993845 1908993846 1908993847 1908993848 1908993849 1908993850 1908993851 1908993852 1908993853 1908993854 1908993855 1908993856 1908993857 1908993858 1908993859 1908993860 1908993861 1908993862 1908993863 1908993864 1908993865 1908993866 1908993867 1908993868 1908993869 1908993870 1908993871 1908993872 1908993873 1908993874 1908993875 1908993876 1908993877 1908993878 1908993880 1908993880 1908993881
(Previous phone numbers: 01908993810 01908993809 01908993808 01908993807 01908993806 01908993805 01908993804 01908993803 01908993802 01908993801 01908993800 01908993799 01908993798 01908993797 01908993796 01908993795 01908993794 01908993793 01908993792 01908993791 01908993790 01908993789 01908993788 01908993787 01908993786 01908993785 01908993784 01908993783 01908993782 01908993781 01908993780 01908993779 01908993778 01908993777 01908993776 01908993775 01908993774 01908993773 01908993772 01908993771 01908993770
Next phone numbers: 01908993812 01908993813 01908993814 01908993815 01908993816 01908993817 01908993818 01908993819 01908993820 01908993821 01908993822 01908993823 01908993824 01908993825 01908993826 01908993827 01908993828 01908993829 01908993830 01908993831 01908993832 01908993833 01908993834 01908993835 01908993836 01908993837 01908993838 01908993839 01908993839 01908993840 01908993841 01908993842 01908993843 01908993844 01908993845 01908993846 01908993847 01908993848 01908993849 01908993849 01908993850)
+44 01908993811 reviews
Add your opinion about +441908993811
UK 1908993811
how call me from this number
Who called from number 1908993811
You can rate other simmilar phone numbers from Milton Keynes, searched in our database
| 1908917480 | 1908997356 | 1908952457 |
| 1908236705 | 1908129246 | 1908747801 |
Random searched phone numbers
| 622 604 6821 | 648 193 7751 | 537 266 3654 |
| 323 159 1664 | 455 829 6160 | 490 713 3448 |
Top rated phone numbers
2036300289 Called from 01274797005 recorded message call transferred to 02036300251 this was the number he gave meSaid call blocking service better than my provider wanted card details confirmed expiry date and renewal not sure if genuine so ended call7799581681 classic vehicle solutions horsham
1484863114 Phoned several times today - a different caller each time or at least a different nametrying to pull the microsoft scam
7539447838 CHESTER
1768779798 Keswick
7870719063 HMRC Scam - automated voice clicked in quite quickly when I answered the call I didnt speak but simply ended the call and blocked future calls
1865861982 Oxford
2038070432 SCAM
1059217066 Fraud
1761752553 new paradise fitness timsbury bath
204754582 Ditto the above
7541960318 Bradford
1480260304 has a phone call from someone called Abrahams claiming he was from BTC about a PPI claim told them to go forth and multiply or words to that effect
2074649958 SCAM
8456801900 cognesia ltd london
6646432325 123bunga entertainment ltd twickenham england
7577957946 London
1332333853 Fraud - automated message stating they are from HMRC and that I have a pending Fraud case and if I dont press 1 I will be arrested shortly Currently sitting with a cup of coffee waiting for the police -P
1639617390 dont know who is ringing but will not answer as they all want something that I do not want
775496183 Fraud
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1914309446 be modern ltd jarrow
1413045900 SPAM
7378459302 Answered and it then somehow turned the call around so that I was calling them Clever But annoying
735556903 Scam number
1513758977 Missed call from this number so called back - quotIt039s regarding your accident recentlyquot so immediately blocked the number
7811144874 London
1412129549 Called and hung up when answered
1415641761 Claims to be talking about problems with Excel - but this is likely to be log-on-to-our-website and let us mend your computer scam RING OFF
1668491713 CAH quotyou have been involved in an accidentquot
Number popularity chart 1908993811
Your opinion about telephone number 1908993811 (190 899 3811)
Reverse Phone Check: Called Milton Keynes ??? Your information about who called from number 01908993811 to you will be stored in our database of landline and mobile numbers. Sharingmessage with other users can prevent many threats or form positive feedback on subject of a given telephone or company number. Warning of others about the risks of receiving dangerous and paid phone calls is now an important piece of information that you can use protect against fraud or extortion resulting from high telecommunications fees among others for calling back, writing an SMS, answering a telephone. Maybe somebody called on a loan or a loan, payday or on third party insurance or flat insurance. Someone could also call from a bank or debt collection. How call me from this number. Someone could have contacted the hotel regarding a vacation or holiday, from a service company regarding the service ordered, or called a courier with a parcel to be delivered purchased on the allegro or online store. From what network he called to me?
Possible number records of 01908993811 01908-993-811
+441908993811 |
00441908993811 |
1908 993 811 |
19 08 99 381 1 |
190 89 93 81 1 |
19-08-99-381 1 |
0044 1908-993-811 |
00 44 190 89 93 811 |
(+44)1908993811 |
19 08 99 381 1 |
(19) 0899 381 1 |
00 44 (19)0 89-93-81-1 |
+441908993811 In words... 190 899 3811
one thousand nine hundred eight nine hundred ninety three eight hundred eleven |
one billion nine hundred eight million nine hundred ninety three thousand eight hundred eleven |
Possible number records of 1908993811
Last rated phone numbers
7957699032, 2035142374, 7424920949, 1223748197, 1204806930, 2045244253, 1484315394, 1473241095, 800773878, 2045867078, 63366, 7359861807, 2037697922, 1618186041, 353851959582, 353852401057, 353851968476, 353851943540, 353876707314, 2033181936, 7727425284, 7446976902, 2087871412, 2038621949, 3303413407, 7940490700, 2038687170, 7462702574, 7462702574, 1416736059, 1227915331, 7830302193, 7472127533, 2382622057, 2039051243, 2045384813, 7498540186, 7588518777, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2045796786, 2920084671, 1916597961, 420414529983, 7893914507, 2045765114,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13304
- Users online : 174
- Bots online : 13130
- Google Bots : 1
- Unique users : 140
- Unique bots : 443
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985161320
- Pageviews today : 619330
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1908993811
+441908993811
homserve Tv insurance
catherine costas enfield enfield
Told me I had a problem with my windows pc. Kept them on the line for 45 mins. They then asked was I going to be interested or was I taking the piss? Told them I had a Mac and yes I was taking the piss. I then hung up. Hehehe.
‘American ‘ accent purports to be from Hrmc investigating criminal offences - threatens arrest if you don’t press#1
Halifax
Safe number
underscore design llp london london
Everytime I answer we get cut off
SCAM
Scam automated phone call about county court and mentioned to call back to stop etc.
Called to confirm domain. Legit and all good :)
SCAM SCAM from India. Pretending to offer a good phone contract SCAM
SPAM
Hello you are entitled to ppi....... Claimed it already goodbye, just hang up!!!!
Fraud
SCAM / SPAM Transaction of £600 made to foreign country half an hour ago. Automated call but doesn't say which bank - just to press 3 to talk to someone from your card provider. DO NOT RESPOND.
SCAM some automated message about legal action. There are so many adds on this whocalledme page I can hardly use it.
Aberdeenshire
Harassment
It was an accident hoax, car accident in the past
Portslade
7940447791
Watford
This number called me and I questioned them on it. When they ask me if I use any of their cards, I said no. They hung up and refuse to accept the call.
SCAM
Scam
SCAM
London
Unsolicited call, hangs up when you answer.
Safe number
SCAM claimed to be BT, re internet, press 1 to speak to an advisor, no contract with by
HMRC Scam - automated voice clicked in quite quickly when I 'answered' the call. I didn't speak but simply ended the call and blocked future calls.
Unwanted sale call...
Redditch
SCAM / SPAM
SCAM
From a recruitment consultant
This is for a financial claim and I asked to be removed from there system and was apologised to and received a call from a the manager who further apologised for the call and assured me that I will not receive any further calls, he then went onto give me some advice against an issue I have currently which he really did not need to do, very polite chap and having looked up the Company details they are legit and dealing with a few areas for financial claims, this is not a scam and the guys are very polite.
Crunch Accounting
Vanquis Bank are sneaky and use lots of different telephone numbers to trick you into answering. For your convenience, I have listed many of the telephone numbers that they use below. If you answer calls from these numbers you may be charged for Debt Management so buy a BT8500 and stop all of these calls easily. Block these numbers: 01214391218 01214395279 01225920251 01253423398 01272757105 01273945017 01274966163 01277500081 01316290069 01412371287 01412371498 01412371532 01412372045
one steppe ahead london london
Insurance
tariffmatch global ltd sevenoaks kent
Letchworth Garden City
rising stars sc manchester lan
SCAM, it keeps charging me £4.50 for sending me textsi have NOT subscribed to nor received and ALL attempts to send, STOO to this number has failed, I'm at my wits end with this
Courier
Totnes
Sales call Friendly number Escort from Liverpool using this
Keep having calls from this number.
I didn t answer as I didn t recognise the number. They rang yesterday at 6.30pm and today at 10.45am, no message was left. In the unlikely event that the call was from Talk Talk, I have never dealt with that company, so they would have no legitimate reason to ring me.
Fraud
SPAM
Private number
they said excellent so many times that I was s**ked in
We had the worst experience of a conservatory. See google reviews and trust pilot by my husband! Yet they still call to see if we want anything else. Would rather boil my eyes than use this company again!
SCAM
has a phone call from someone called Abrahams claiming he was from B.T.C about a P.P.I claim ...told them to go forth and multiply or words to that effect
BARROW-IN-FURNESS
London
Edinburgh
mark coleman ilford essex
London
Missed call
It s Watford General Hospital.
SCAM show up as Edinburgh Sheriff Court and then an automated messaged saying my National Insurance is going to be threatened. Hang up as this is a scam
Automated call
SCAM
Keeps ringing, don’t answer and seems scam as no message and can’t ring back.
Mytchett
Spam call regarding my phone
Good and okay
Missed call from this number so called back - "It's regarding your accident recently"..... so immediately blocked the number.
Silent call
07729359245
Banstead
SCAM - I've apparently had my NI number suspended and am about to be arrested!
Check the URL for spelling mistakes. Back to the tellows homepage.
natalie montique london london
Courier
Sales call from the company called mend.io
Holton Heath / Poole
Silent call
michael hull kingston upon thames surrey
Man with Scottish accent spoke to ask how I was, then I asked 'Who are you?' and he hung up!
The overall rating for phone number 07949859102 is Dangerous
SCAM SCAM SCAM SCAM SCAM
Fraud
Call received today (7 March 2016), the female caller telling me she wanted to talk about an accident I had in past two and a half years. Claimed there must have been a mistake...
Called looking for someone who had my phone number before me.
ppi rang and hung up so i called them back
Missed a call from this number
Yarm
This is a call centre calling you to confirm who you are, they then hang up & you can't call them back, at a guess some kind of scam.
SCAM
To the preceding Anonymous:- Maybe your Telecoms provider could block this number for you, but you can block it yourself via the free-and-excellent BT CALL PROTECT or similar, v...
Received a call from this number I tried calling back no mention of a company or anything, just says "your call is very important to us please wait for Ana available agent&...
Scam
Someone calling from "one family" trying to get me to sign up for an under 16s junior ISA
Called but left no message??