1925188029 (01925188029)
Who called me from phone number 1925188029 Warrington
Who called me from 1925188029
Phone number 1925188029 it's a landline number from Warrington. This phone number has been searched 1 times. The first search was on 2026-02-16 08:34:18 and the last on 2026-02-16 09:35:18. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1925188029 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441925
Phone number 1925188029 - 0 opinions
Reviews for phone number 1925188029
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1925188029
QR Codes for number +44 1925188029




Phone number 1925188029 (+441925188029)
Country: United Kingdom
Country code: +44 (0044)
City: Warrington
Directional local: 1925 (01925)
Code: 441925 (00441925)
This number was searched 1 times
First date of search: 2026-02-16 08:34:18
Date of last check of this number: 2026-02-16 09:35:18
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 208815291
A similar number: 192518747, 192518691, 192518688, 192518232, 199518802, 199518802, 192718802, 192818802(19 25 18 747,19 25 18 691,19 25 18 688,19 25 18 232,19 95 18 802,19 95 18 802,19 27 18 802,19 28 18 802)
Previous phone numbers: 1925188028 1925188027 1925188026 1925188025 1925188024 1925188023 1925188022 1925188021 1925188020 1925188019 1925188018 1925188017 1925188016 1925188015 1925188014 1925188013 1925188012 1925188011 1925188010 1925188009 1925188008 1925188007 1925188006 1925188005 1925188004 1925188003 1925188002 1925188001 1925188000 1925187999 1925187998 1925187997 1925187996 1925187995 1925187994 1925187993 1925187992 1925187991 1925187990 1925187989 1925187988 1925187987 1925187986 1925187985 1925187984 1925187983 1925187982 1925187981 1925187980 1925187979 1925187978 1925187977 1925187976 1925187975 1925187974 1925187973 1925187972 1925187971 1925187970 1925187969 1925187968 1925187967 1925187966 1925187965
Next phone numbers: 1925188030 1925188031 1925188032 1925188033 1925188034 1925188035 1925188036 1925188037 1925188038 1925188039 1925188040 1925188041 1925188042 1925188043 1925188044 1925188045 1925188046 1925188047 1925188048 1925188049 1925188050 1925188051 1925188052 1925188053 1925188054 1925188055 1925188056 1925188057 1925188057 1925188058 1925188059 1925188060 1925188061 1925188062 1925188063 1925188064 1925188065 1925188066 1925188067 1925188068 1925188069 1925188070 1925188071 1925188072 1925188073 1925188074 1925188075 1925188076 1925188077 1925188078 1925188079 1925188080 1925188081 1925188082 1925188083 1925188084 1925188085 1925188086 1925188087 1925188088 1925188089 1925188090 1925188091 1925188092 1925188093 1925188094 1925188095 1925188096 1925188098 1925188098 1925188099
(Previous phone numbers: 01925188028 01925188027 01925188026 01925188025 01925188024 01925188023 01925188022 01925188021 01925188020 01925188019 01925188018 01925188017 01925188016 01925188015 01925188014 01925188013 01925188012 01925188011 01925188010 01925188009 01925188008 01925188007 01925188006 01925188005 01925188004 01925188003 01925188002 01925188001 01925188000 01925187999 01925187998 01925187997 01925187996 01925187995 01925187994 01925187993 01925187992 01925187991 01925187990 01925187989 01925187988
Next phone numbers: 01925188030 01925188031 01925188032 01925188033 01925188034 01925188035 01925188036 01925188037 01925188038 01925188039 01925188040 01925188041 01925188042 01925188043 01925188044 01925188045 01925188046 01925188047 01925188048 01925188049 01925188050 01925188051 01925188052 01925188053 01925188054 01925188055 01925188056 01925188057 01925188057 01925188058 01925188059 01925188060 01925188061 01925188062 01925188063 01925188064 01925188065 01925188066 01925188067 01925188067 01925188068)
+44 01925188029 reviews
Add your opinion about +441925188029
UK 1925188029
mobile online
Who called from number 1925188029
You can rate other simmilar phone numbers from Warrington, searched in our database
| 1925164577 | 1925122423 | 1925170753 |
| 1925153552 | 1925960558 | 1925225364 |
Random searched phone numbers
| 612 410 4912 | 195 089 7512 | 774 311 0404 |
| 934 266 7108 | 999 735 4166 | 623 074 1438 |
Top rated phone numbers
7835001541 Worthing7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
2079461958 Phoned me 9 times over a 3 day period when I picked the number up an aggressive Pakistani man said I d had an accident and told me someone was suing me for hitting their car I told him not to call and he used the term Fk off to me then put the phone down but within the hour he had called again twiceI proceeded to say I would report him to the Police he shouted something at me and put the phone down again I had a further 4 calls in the coming days each week averaging 12 calls
3385567987 Telemarketing
7736543258 Pont-Y-Clun
7500090850 Fraud
1254678847 This number called today saying he was calling from the call blocking service and wanted me to confirm the expiree date of my bank card Refused and he dropped the call I refused
7703574775 ivata limited dundee tayside
7905683369 mr milas london na
2036178365 The overall rating for phone number 02036178365 is Dangerous
1202159290 Chris my local energy adviser calls every day I have asked for my number to be removed from their list His response No
2085721201 Didnt speak when spoken too hanged up
1212187048 Rang from a call centre Would not give his name Wanted to speak to my partner thanked me and rang off when I said they were busy on another lineamp13nSounds to me as though th
2089581535 Silent call Call cut immediately I answered
7506743314 miguel mansfield london xx
1273862295 Similar experience to Jim I told the caller that he was making what I regarded as a nuisance call and put the phone down
2045762286 SCAM Appeared in fake email purporting to come from Ebay
1892740211 Fordcombe
1613064589 Once again the scammers have been found out by trying to 039represent039 both Microsoft and TalkTalk If I was that member of staff and Manchester Uni Id be straight on
7860470504 SCAM Recorded message Amazon scam to landline claiming an IPhone had been purchased on my account for 399 If not authorized to press 1 to get to Amazon customer service 3rd same call of the day from 3 separate Mobile numbers one on Three network last two on O2 network Time the mobile companies were tasked with stopping these calls You have to answer when youre expecting calls
7555225379 made easy concepts-domain for sale sketty swansea
1628780208 karen fry bray berkshire
705847734 Tilbury
7762490512 waltham cross
1543478685 SPAM
7851398178 Wigan
7912173227 ben dunlop oxted oxted
1924280573 Anglian Windows Yorkshire Area office
1159729801 AMAZON
1484442046 Company try to get you to switch energy suppler
Number popularity chart 1925188029
Your opinion about telephone number 1925188029 (192 518 8029)
Phone No Lookup: Called Warrington ( 01925188029) Stay safe through our website with opinions about mobile and landline numbers. Check and add your own opinions about the unknown number you are currently browsing Share with others your experience who called from this phone number. This is very necessary for other users who will check this phone number in the future. Maybe you will someday check this phone number again so our site will serve as a storage space or a base for your opinions and opinions of other users in one place. If you don't know who called you from this unknown phone number, first check this number in our number database. It may be a positive number, but it may turn out that this number is a negative number that causes fees or that Phishing personal data. Mobile online. Perhaps this is the number of an advertising agency or marketing company that wants to offer you unwanted services. Maybe this is a call center that I am trying to reach you in connection with a case in an office or bank or other company. Invite others to use this site to add feedback about unknown phone numbers.
Possible number records of 01925188029 01925-188-029
+441925188029 |
00441925188029 |
1925 188 029 |
19 25 18 802 9 |
192 51 88 02 9 |
19-25-18-802 9 |
0044 1925-188-029 |
00 44 192 51 88 029 |
(+44)1925188029 |
19 25 18 802 9 |
(19) 2518 802 9 |
00 44 (19)2 51-88-02-9 |
+441925188029 In words... 192 518 8029
one thousand nine hundred twenty five one hundred eighty eight twenty nine |
one billion nine hundred twenty five million one hundred eighty eight thousand twenty nine |
Possible number records of 1925188029
Last rated phone numbers
7469656137, 7469656137, 7838260150, 7469656137, 1706300921, 2039362553, 7717492848, 1312299703, 2039741025, 1749813393, 1323761918, 1223969107, 1768489529, 1877550050, 7701407151, 1630659075, 2381683002, 7424, 7512153322, 7700135817, 7763152711, 2080560549, 21676584085, 7441427544, 83845841214, 1218231825, 2381683003, 7403559197, 7860041826, 1254948585, 1423391491, 2045254920, 1969672141, 2034759536, 7968547188, 7718626393, 7418378191, 2030262733, 1218012393, 7778286405, 7700107299, 1752544757, 7563422310, 1514533343, 1514536823, 2071172913, 7778716130, 7495117419, 1915433406, 7407048093,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985038245
- Pageviews today : 496255
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1925188029
+441925188029
This number is linked to Manchester hmp prison aka stangeways
Just called my mobile again.I dont answer unknown calls. I never put my mobile number on any web sites .If i have to put a mobile number i can remember my first mobile number and use thats instead>I think EE has sold my number as they are the only people who know it apart from friends .
craig doran london london
nuisance silent calls. also any time of day up to 8pm. do not respond to them.
Wellingborough
Cold call from telemarketing company based in Manchester claiming to be 02 Partner. Told to fxxk xff and not call me again. Also blocked number on phone but my call logs showed they continued to ring me. Pig stupid or what.
berkshire
Missed calls, called back to automic machine, stella UK, tprobably sold by Vanquis bank. Do not answer or give information. PUT THEM ON HOLD BY PLAYING LOUD ROCK MUSIC DOWN THE PHONE!!! :D :D
Returned call to a number that sounded like it was a dead line. Probably a scam
had a call off this number, didnt recognise it so didnt answer and i dont know anyone in Henley On Thames, no message left so put on block list.
This is one of the numbers that pretends to be from the UKBA to fool international students in the UK and tell them there is something wrong with their imigration application. They have parts of your data (maybe name, zip-code etc.) and they try to get ALL of your information plus your credit card details. Do not give that information!
When I answered the caller could be heard in the background not speaking. After around 3 secs the caller hung up. Very strange.
SCAM / SPAM
Wishaw
Edinburgh
These people are pain in the Arse!!! The number needs to get Blacklisted to stop the people making the annoying calls sometimes at stupid hours!! Sometimes line goes dead
middx
SCAM and FRAUD. Organisation is holding identity information without consent and makes repeat calls.
Beware! Big scam going on I received phone call from 0161 705 5000 been told they are from o2 also they send me an email from the address [email protected] I called O2 a...
STOP CALLING YOU WILL GET NO RESPONSE
Multiple unwanted calls
SCAM they call and say it is HM revenue ans put pressure on you. In one scenario they say you haven't decmare your taxes for the last few years there for you have to pay an amout of many. ( i have been asked to pay 4300 pounds for 4 years of not declaring my income) Please be aware and don't give any details of your bank. Always ask for a claim in writing and make sure they are who they say they are. If in doubt call back not on the number you been called from but to an official number of the service.
Don't answer
SCAM coming from Russian federation.
PLEASE DO NOT ANSWER CALLS FROM THIS NUMBER.....When I answered several months ago the "indian" sounding lady at the other end simply said "we are coming to your house this evening to kill you...what do you think about that?".....I put the phone down...THE POLICE are totally helpless in cases like this...apparently this company is NOT breaking any laws!!!...DO NOT ANSWER....they rang me again today which went unanswered...which proves their stupidity...but then it comes as not surprise!
jeges silk hove england
c o blue soap manchester
Bank/Lonas
andrew ashworth southport merseyside
frank dehn london greater london
Numerous text messages re entitlement to compensation for the mis-selling of PPI
London
SCAM Recorded message Amazon scam to landline claiming an IPhone had been purchased on my account for £399, If not authorized, to press 1 to get to Amazon customer service. 3rd same call of the day, from 3 separate Mobile numbers, one on Three network, last two on O2 network. Time the mobile companies were tasked with stopping these calls! You have to answer when you're expecting calls.
miguel sousa rhydyfelin xx
SCAM / SPAM
Private number
This number is one of many belonging to uncle buck , never leaves a message , constant calling at ridicules times and just won’t accept I’m not the person they are looking for . !!
Scam
London
HMRC Scam Number. Told them I was running a track and trace on them and they hung up on me.
Nuisance unwanted call
Called an asked my name immediately. As as soon as as I said whose calling they hung up. They didn t identify themselves either. Tip: don t answer to your name just ask whose calling before speaking to them.
The overall rating for phone number 03442437777 is Harassing
university of liverpool liverpool
SCAM
SCAM
No answer when picked up call!!!
Unintelligible voicemail, calling every few days from different numbers even 00000000000 call popped up?
matt greaves stourbridge england
SCAM Pretending to be HSBC
ciroqu ltd bournemouth dorset
Maidstone
SCAM
I do not answer this number anymore. On a couple occasions I have and there is silence. When I put the phone down it stops me using it (landline). Phoning my landline number wit...
DLG Auto Services in Orpington.
SCAM / SPAM Robo call claiming to be HMRC fraud office
Block, never had an accident
SCAM, phishing call
mathew jones stockport cheshire
SCAM / SPAM
SCAM / SPAM
Telemarketing
This is Halifax / Bank of Scotland / Lloyds Bank complaints department. If they're calling you then you must have logged your phone number with them and made a complaint.
I don,t know this number
SCAM
Debt collector, Idem servicing
Safe number
Birmingham
Courier
SCAM
elka de wit london
AMAZON
Courier
Silent call nuisance again
hidden industries ltd brighton east sussex
If this number rings you again either answer by saying bonjour then speak as though you are French or German .if this doesn t work tell them you now have their number and will be taking them to the small claims court for harrasment or better still start swearing as though you have Tourette s
HUDDERSFIELD
SPAM
Fraud - was a threatening recorded message saying that I would be arrested immediately if i didn't press 1
Blandford Forum
Same here. Don t know how they got my number
telling you you have a problem with your computer.
Ruthin
charteroak estates limited potters bar, hertfordshire,
nimbus ninety ltd reading reading
SPAM
Bolton
Fraud
London
SCAM
Missed call
Continually ringing, havent answered, interested if anyone else has been contacted
Shazad from serenity apartments in bd7. Thinks he’s gods gift the old fart. how can a business harass girls by taking their number from the booking details. Get a life you pathetic desperado
SPAM
My husband has had this number come up on his phone saying his vodaphone bill not paid, when I checked it had been. Wanted payment details which he wouldn’t give. So yes a scam.
0207-735-3020 Someone telephoned me today 12th April 2017 at 12:51 on that number which I did NOT recognise. Didn't pick up the telephone. Does anyone know who these ...
Positive number
Fraud
bamidele raheem london england
Spam