1925190572 (01925190572)
Who called me from phone number 1925190572 Warrington
Who called me from 1925190572
Phone number 1925190572 it's a landline number from Warrington. This phone number has been searched 1 times. The first search was on 2026-02-16 08:36:26 and the last on 2026-02-16 09:37:26. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1925190572 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441925
Phone number 1925190572 - 0 opinions
Reviews for phone number 1925190572
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1925190572
QR Codes for number +44 1925190572




Phone number 1925190572 (+441925190572)
Country: United Kingdom
Country code: +44 (0044)
City: Warrington
Directional local: 1925 (01925)
Code: 441925 (00441925)
This number was searched 1 times
First date of search: 2026-02-16 08:36:26
Date of last check of this number: 2026-02-16 09:37:26
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 750915291
A similar number: 192519544, 19251910, 192519740, 192519149, 197219057, 197219057, 193719057, 197519057(19 25 19 544,19 25 19 10,19 25 19 740,19 25 19 149,19 72 19 057,19 72 19 057,19 37 19 057,19 75 19 057)
Previous phone numbers: 1925190571 1925190570 1925190569 1925190568 1925190567 1925190566 1925190565 1925190564 1925190563 1925190562 1925190561 1925190560 1925190559 1925190558 1925190557 1925190556 1925190555 1925190554 1925190553 1925190552 1925190551 1925190550 1925190549 1925190548 1925190547 1925190546 1925190545 1925190544 1925190543 1925190542 1925190541 1925190540 1925190539 1925190538 1925190537 1925190536 1925190535 1925190534 1925190533 1925190532 1925190531 1925190530 1925190529 1925190528 1925190527 1925190526 1925190525 1925190524 1925190523 1925190522 1925190521 1925190520 1925190519 1925190518 1925190517 1925190516 1925190515 1925190514 1925190513 1925190512 1925190511 1925190510 1925190509 1925190508
Next phone numbers: 1925190573 1925190574 1925190575 1925190576 1925190577 1925190578 1925190579 1925190580 1925190581 1925190582 1925190583 1925190584 1925190585 1925190586 1925190587 1925190588 1925190589 1925190590 1925190591 1925190592 1925190593 1925190594 1925190595 1925190596 1925190597 1925190598 1925190599 1925190600 1925190600 1925190601 1925190602 1925190603 1925190604 1925190605 1925190606 1925190607 1925190608 1925190609 1925190610 1925190611 1925190612 1925190613 1925190614 1925190615 1925190616 1925190617 1925190618 1925190619 1925190620 1925190621 1925190622 1925190623 1925190624 1925190625 1925190626 1925190627 1925190628 1925190629 1925190630 1925190631 1925190632 1925190633 1925190634 1925190635 1925190636 1925190637 1925190638 1925190639 1925190641 1925190641 1925190642
(Previous phone numbers: 01925190571 01925190570 01925190569 01925190568 01925190567 01925190566 01925190565 01925190564 01925190563 01925190562 01925190561 01925190560 01925190559 01925190558 01925190557 01925190556 01925190555 01925190554 01925190553 01925190552 01925190551 01925190550 01925190549 01925190548 01925190547 01925190546 01925190545 01925190544 01925190543 01925190542 01925190541 01925190540 01925190539 01925190538 01925190537 01925190536 01925190535 01925190534 01925190533 01925190532 01925190531
Next phone numbers: 01925190573 01925190574 01925190575 01925190576 01925190577 01925190578 01925190579 01925190580 01925190581 01925190582 01925190583 01925190584 01925190585 01925190586 01925190587 01925190588 01925190589 01925190590 01925190591 01925190592 01925190593 01925190594 01925190595 01925190596 01925190597 01925190598 01925190599 01925190600 01925190600 01925190601 01925190602 01925190603 01925190604 01925190605 01925190606 01925190607 01925190608 01925190609 01925190610 01925190610 01925190611)
+44 01925190572 reviews
Add your opinion about +441925190572
UK 1925190572
phone call recorder
Who called from number 1925190572
You can rate other simmilar phone numbers from Warrington, searched in our database
| 1925145865 | 1925163110 | 1925145675 |
| 1925361810 | 1925849142 | 1925432264 |
Random searched phone numbers
| 907 867 2939 | 401 711 6583 | 989 379 0200 |
| 783 585 7939 | 569 163 4577 | 579 263 4520 |
Top rated phone numbers
1446710958 SCAM - clearly someone trying to get info about bank details Rang pretending to be from my bank - starts with an automated message stating a large amount of money has been requested from account amp if not authorised press 1 Person then answers but does not know namedetails etc amp tries to get you to give details Be really careful with this number - clearly fraudstersscammers1258452496 Blandford Forum
7825771249 Hessle
1134199885 Missed call from this number No message left Unknown caller Did not recognise the number
1772894752 media innovation studio preston lancashire
1133202567 Just caled from this numberdont know it didnt answerchecked and blocked28th jan915am
9957773401 Private number
1933000541 I had a call from a French number amp13n33 7 82 16 52 10 Proceeded immediately by this number Only rang for a fe seconds Dialled the number bug said was incorrect
7468488624 London
7900016446 Annoying number that calls rings once and hangs up each day
7459679867 LONDON
7712837196 TAXES HMRC
2070976517 Yes I to had a call from some sort of accident help line I actually opted in for the call so I could tell them to stop ringing then when I told them I039d never had accident
7548670133 GLASGOW
1666800086 Called from btc claims unsolicited call Blocked and forgotten about
1615244134 ITS A DANGEROUS SCAM A computer is dialling numbers in sequence to sniff out voice lines If you speak then the line is detected as an active voice line and logged as such a scammer will then be calling you later If you dont recognize the number calling DONT SPEAK JUST LISTEN If you dont hear a voice and then the line goes dead then congratulations - you have just successfully escaped being scammed THESE CALLS ARE HARASSING AND ALWAYS POTENTIALLY DANGEROUS
2083327227 SPAM one of many numbers to call me which are apparently some random shops around the UK like premier sainsburys and a Turkish restaurant Now this Apparently a newsagents I think its someone spoofing using their numbers to scam people
37264507676 Answered mobike call to get message I had missed a call and that my internet connection was being stopped due to illegal activity Anyone else had this
1228546101 Yes I too had a call from this number claiming to be TalkTalk Put phone down
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1513151268 Fraud
7858129389 44 7858 129389 This number is being used to fetch and scamming money posing as traveler and investor
8534898751 8534898751
798310244 Maidstone
7425150922 inter student housing london newham
3331552939 The overall rating for phone number 03331552939 is Harassing
7412695242 SCAM Chinese Facebook dating scam usually African Indian scammer
2074189254 Fraud Automated message telling me I had an arrest warrant and to push 1 for more options
1316480429 Pensions marketing Was polite and said he d remove my details
1619745838 fed up from this number called
Number popularity chart 1925190572
Your opinion about telephone number 1925190572 (192 519 0572)
Free Phone Number Lookup: Called Warrington ??? Your information about who called from number 01925190572 to you will be stored in our database of landline and mobile numbers. Sharingmessage with other users can prevent many threats or form positive feedback on subject of a given telephone or company number. Warning of others about the risks of receiving dangerous and paid phone calls is now an important piece of information that you can use protect against fraud or extortion resulting from high telecommunications fees among others for calling back, writing an SMS, answering a telephone. Maybe somebody called on a loan or a loan, payday or on third party insurance or flat insurance. Someone could also call from a bank or debt collection. Phone call recorder. Someone could have contacted the hotel regarding a vacation or holiday, from a service company regarding the service ordered, or called a courier with a parcel to be delivered purchased on the allegro or online store. From what network he called to me?
Possible number records of 01925190572 01925-190-572
+441925190572 |
00441925190572 |
1925 190 572 |
19 25 19 057 2 |
192 51 90 57 2 |
19-25-19-057 2 |
0044 1925-190-572 |
00 44 192 51 90 572 |
(+44)1925190572 |
19 25 19 057 2 |
(19) 2519 057 2 |
00 44 (19)2 51-90-57-2 |
+441925190572 In words... 192 519 0572
one thousand nine hundred twenty five one hundred ninety five hundred seventy two |
one billion nine hundred twenty five million one hundred ninety thousand five hundred seventy two |
Possible number records of 1925190572
Last rated phone numbers
1644216568, 7754920968, 44775107795, 120461121, 1442392324, 7741293282, 2031293300, 7908670414, 7401932396, 1189422010, 2080560783, 2045711342, 7803471903, 1260591147, 1296711109, 1615452042, 1234632191, 2045796687, 7949188795, 8008021456, 7340287161, 7926771721, 1617186104, 1235627615, 8458520770, 1206805914, 132437153, 7477189744, 1257470647, 1257470647, 7700169047, 7500124751, 7359322717, 3156325794, 1330567147, 2031487678, 8442843421, 7591335998, 1285332633, 2037810895, 1422774506, 1618189743, 7548881046, 1329558540, 1902937418, 1235627887, 7458030387, 7984162540, 2080495903, 1515257555,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985040128
- Pageviews today : 498138
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1925190572
+441925190572
This number is linked to Manchester hmp prison aka stangeways
Claiming to be from BT
SCAM / SPAM
never answered came up as Glasgow .
Very trustworthy
A nuisance call, hung up
Scam
Terrible company, do not deal with them.
Stafford
Harassment call ,they queep calling and don t speak
SCAM no answer or reply when you answer phone. its a EE network number some where in Manchester, information from WHO CALLED ME site.
Positive number
z-code limited london
London
nq independent manchester greater manchester
Silent call
Missed call
myminidisco.com shropshire midlands
Positive number
Tax scam,
Kieren, please note that this is a virtual geographic number (along with those ending 026,045, 143, 235, 315, 338, 374, 478, 485 and 805) and thus purporting to be from Preston ...
SCAM called about HMRC pending action...nothing to do with us
Wanted me to sign on my computer to find my internet speed claiming to be from BT so I hung up bit suspicious as it was a local number
SCAM / SPAM
Erith
Bunda
SCAM A text message from "three" about cutting off my services and asking me to log on with a link. Never had an account with three
praivat
SCAM / SPAM Flash Expert Guidance. A robot asking me if I had had a no fault accident. I say YES. The very same voice came on the phone, and when I pointed that out, she hung up. Scumbag.
Scam
christopher conrad london greater london
Manchester
Call every hour from 7am till 12am, 7 days a week...!! Bloody annoying idiots...!!
SCAM / SPAM
Insurance Knew my first name Were checking about a life insurance policy I don’t have with them Polite when informing not interested, they said would delete number. However, unsure if they just want led confirmation of name even though unlikely
London
I m being charged for 5 calls I did not make to this premium number. I have no idea who it is but if anyone sees it on the bills, it is a scam.
Maidstone
SPAM one of many numbers to call me which are apparently some random shops around the U.K. like premier, sainsburys and a Turkish restaurant. Now this ! Apparently a newsagents. I think it’s someone spoofing using their numbers to scam people..
Manchester
lanemorris oxford oxford
Silent call
Asked to speak to someone that wasn t me .told them so and hung up. Asian sounding gentleman, possible scam handle with care
It was an accident hoax, car accident in the past
rakela hair fashion ltd westcliif-on-sea essex
SCAM
This number has sent me a bogus text to get in contact re; a direct debit. Do not call this number!
SCAM Another Amazon Prime scam. Is it a coincidence that I have been in contact with Amazon regarding another matter ???
got a call earlier on in the weak from a northern idiot goes by the name of rob i have never ever been spoken to with just a nasty attitude this needs to be stopped
Spam
16 Dec 2021 - Fake o2Reply
Accident
SCAM
A company keeps calling me and says they have 3 questions... i tell them the details they have for me are incorrect. they hang up as soon as i challenge anything
Royal national institute for the blind canvassing for support/donations
eska international birmingham birmingham
Good
Plymouth
Got dead threaths from this number by whatsapp and told to pay money.
"We believe you have been involved in a car accident that was not your faulT
Started by asking to speak to the business owner which ia a red flag for me then claimed to be from google, back down when queried and said they were a partner, then becamse abusive when I asked them to not call again. Blocked
Positive number
SCAM now blocked
silent call from this number which appears to be St Helens Hospital?? as my number is ex-directory and TPS registered this is obviously a scam/fraud call. and Hospital Switchboard number totally different. reported to Ofcom
Automated call
Since getting new sim this number has called at least twice a day every day including sundays. Glad I ignored it as the first few calls only my children had my number so it was not anyone or business I knew. Cannot belive they can do this for over 2 months everyday when ddo they get the message. Now blocked the number so no more annoying calls at work
Fraud Claiming to be HMRC Tax Fraud Office.
Missed call from this number
SPAM
yes, good thing i didnt call them back!!! theyre really irritating
London
Foreign woman claiming to be from Amazon regarding supposed order. Think this is a SCAM!
Aylesbury
London
Called me at 23:30 !! I thought it was bad news about my elderly father!! But it was some bright idiot saying he was IT Support and his records showed I was available until 01:00 ... total rubbish. Ignore this idiot
Fraud
promate ltd london london
My Pixel phone flashed red for scam call so I didn't answer. Checked the no. on this site & am grateful to previous contributors. The no. is now blocked.
javier rodriguez london n a
e&e ltd london
SCAM , the caller when i call back he / she is dropping the call
This number is uncle buck (payday loan company)
jason bevan pontypridd cardiff
Never call unknown numbers back as you may be calling a Premium Rate or International number masked by a spoofed UK number which will be a very expensive call.
Scam! Automated voice saying that my bank card had been used for a £300 Amazon Gift Card.
hunsbury heating northampton
01811515062
Fraud
SCAM
miguel sousa rhydyfelin xx
Its payday uk calling from this number
Bacup
This number fraudulently claims to be police asking to call them back to speak to a Police Officer in order to fine you for fraudulent activity on your phone using your own NI number.
Got a call asking if a certain person was in, I stated they were working away until Friday. caller asked if it would be okay for them to call on said Friday. I said yes. to whic...
BATTLE
don't know this didn't answer it
built wimborne
forever alive preston lancs
EDINBURGH
Northampton