1925766036 (01925766036)
Who called me from phone number 1925766036 Warrington
Who called me from 1925766036
Phone number 1925766036 it's a landline number from Warrington. This phone number has been searched 1 times. The first search was on 2026-02-16 08:33:47 and the last on 2026-02-16 09:34:47. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1925766036 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441925
Phone number 1925766036 - 0 opinions
Reviews for phone number 1925766036
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1925766036
QR Codes for number +44 1925766036




Phone number 1925766036 (+441925766036)
Country: United Kingdom
Country code: +44 (0044)
City: Warrington
Directional local: 1925 (01925)
Code: 441925 (00441925)
This number was searched 1 times
First date of search: 2026-02-16 08:33:47
Date of last check of this number: 2026-02-16 09:34:47
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 306675291
A similar number: 192576112, 192576488, 192576802, 192576876, 199576603, 199576603, 198376603, 196176603(19 25 76 112,19 25 76 488,19 25 76 802,19 25 76 876,19 95 76 603,19 95 76 603,19 83 76 603,19 61 76 603)
Previous phone numbers: 1925766035 1925766034 1925766033 1925766032 1925766031 1925766030 1925766029 1925766028 1925766027 1925766026 1925766025 1925766024 1925766023 1925766022 1925766021 1925766020 1925766019 1925766018 1925766017 1925766016 1925766015 1925766014 1925766013 1925766012 1925766011 1925766010 1925766009 1925766008 1925766007 1925766006 1925766005 1925766004 1925766003 1925766002 1925766001 1925766000 1925765999 1925765998 1925765997 1925765996 1925765995 1925765994 1925765993 1925765992 1925765991 1925765990 1925765989 1925765988 1925765987 1925765986 1925765985 1925765984 1925765983 1925765982 1925765981 1925765980 1925765979 1925765978 1925765977 1925765976 1925765975 1925765974 1925765973 1925765972
Next phone numbers: 1925766037 1925766038 1925766039 1925766040 1925766041 1925766042 1925766043 1925766044 1925766045 1925766046 1925766047 1925766048 1925766049 1925766050 1925766051 1925766052 1925766053 1925766054 1925766055 1925766056 1925766057 1925766058 1925766059 1925766060 1925766061 1925766062 1925766063 1925766064 1925766064 1925766065 1925766066 1925766067 1925766068 1925766069 1925766070 1925766071 1925766072 1925766073 1925766074 1925766075 1925766076 1925766077 1925766078 1925766079 1925766080 1925766081 1925766082 1925766083 1925766084 1925766085 1925766086 1925766087 1925766088 1925766089 1925766090 1925766091 1925766092 1925766093 1925766094 1925766095 1925766096 1925766097 1925766098 1925766099 1925766100 1925766101 1925766102 1925766103 1925766105 1925766105 1925766106
(Previous phone numbers: 01925766035 01925766034 01925766033 01925766032 01925766031 01925766030 01925766029 01925766028 01925766027 01925766026 01925766025 01925766024 01925766023 01925766022 01925766021 01925766020 01925766019 01925766018 01925766017 01925766016 01925766015 01925766014 01925766013 01925766012 01925766011 01925766010 01925766009 01925766008 01925766007 01925766006 01925766005 01925766004 01925766003 01925766002 01925766001 01925766000 01925765999 01925765998 01925765997 01925765996 01925765995
Next phone numbers: 01925766037 01925766038 01925766039 01925766040 01925766041 01925766042 01925766043 01925766044 01925766045 01925766046 01925766047 01925766048 01925766049 01925766050 01925766051 01925766052 01925766053 01925766054 01925766055 01925766056 01925766057 01925766058 01925766059 01925766060 01925766061 01925766062 01925766063 01925766064 01925766064 01925766065 01925766066 01925766067 01925766068 01925766069 01925766070 01925766071 01925766072 01925766073 01925766074 01925766074 01925766075)
+44 01925766036 reviews
Add your opinion about +441925766036
UK 1925766036
01709 phone area code
Who called from number 1925766036
You can rate other simmilar phone numbers from Warrington, searched in our database
| 1925784507 | 1925749254 | 1925714129 |
| 1925737967 | 1925812511 | 1925115646 |
Random searched phone numbers
| 542 781 4900 | 490 484 5593 | 606 821 9348 |
| 324 686 3068 | 800 277 3482 | 271 869 6335 |
Top rated phone numbers
7889631730 London1419465960 SCAM SPAM
7438203588 Claimed to be from Amazon saying someone had ordered a iphone using my account and did I want to cancel the order When I said I will call her back she hung up
35722032305
2083705195 SCAM - pretended to be British Telecom - telling me they were going to disconnect my landline because suspicious activity had occurredI didnt listen to any more
7979500964 exonms thunderlsey essex
7737866924 Automated message claiming to be from Amazon Prime regarding automatic subscription of 7999 SCAM
1217948637 Claimed I had had an accident that wasn t my fault But had no details
7555225379 made easy concepts-domain for sale sketty swansea
1212333963 eska international birmingham birmingham
7581003303 Haywards Heath
7702876702 SCAM - National Crime Agency suspicious credit card usage time critical to contact us etc etc
2102490540 ppi automated call
1315496521 Definitely a scam BT Openreach TalkTalk Virgin etc will never call you about a technical issue unless you contact them Any call about your computer router viruses IP a
1389294608 American recorded voice told me that I had had a law suit filed against me Asked me to press 1 to contact my case officer Obviously I did not do so Obvious scam
2034768490 Safe number Great Ormond Street childrens hospital charity conformation phone call about donation Expected phone call
7508592560 SCAM
2031291371 laverigifts london greater london
1624622318 Automated scam for Amazon
1224928172 SCAM pretending to be from bank about large payment to go through Do not press 1
1204490113 Fraud SCAMI didnt answer it and it went on voicemail It was a machine voice that threatened me to press a number otherwise HMRC will issue a warrant to arrest me D
1245454705 Car going in for service salesman looking for more business
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
7907951898 48litresoffunk cardiff n a
7841641818 Seaham
989339584828 Courier
7074632561 07074632561 Amazon prime renewal scam
1202159290 Chris my local energy adviser calls every day I have asked for my number to be removed from their list His response No
7887942826 No idea who this is so pos a scam
2085814072 Scam pretending to be HMRC saying an arrest warrant had been issued against me and I should press 1Number registered to a dry cleaners in Hayes
Number popularity chart 1925766036
Your opinion about telephone number 1925766036 (192 576 6036)
Reverse Cell Number Lookup: Called Warrington ??? Add your opinion about this phone number, maybe you know who called from number 1925 766 036? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. 01709 phone area code. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 019 25 76 603) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 01925766036 01925-766-036
+441925766036 |
00441925766036 |
1925 766 036 |
19 25 76 603 6 |
192 57 66 03 6 |
19-25-76-603 6 |
0044 1925-766-036 |
00 44 192 57 66 036 |
(+44)1925766036 |
19 25 76 603 6 |
(19) 2576 603 6 |
00 44 (19)2 57-66-03-6 |
+441925766036 In words... 192 576 6036
one nine two five seven six six zero three |
nineteen twenty five seventy six sixty thirty six |
Possible number records of 1925766036
Last rated phone numbers
7359340657, 7359828840, 7942051543, 7368306262, 7359825615, 2922640201, 4917655756277, 212646663105, 2031371870, 7477172814, 2922711579, 7768210969, 1758265326, 7518173234, 19095701903, 1324232041, 7893, 1202933184, 2922641913, 7588685354, 35722032305, 1156610601, 1135127671, 3330459521, 330459561, 1135190879, 8445301538, 353877821258, 7801476318, 7445742398, 63366, 8000113312, 7473168971, 7763449748, 8659732684, 7552273486, 2039365022, 2039365021, 2039365021, 2039365022, 1515561109, 2039365022, 2039365022, 2039365022, 8451340019, 4915172166153, 7479929342, 2039365022, 1782890924, 1143603919,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985037804
- Pageviews today : 495814
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1925766036
+441925766036
Silent call.No message left. 1st time on my landline
Typical **** auto recorded message about debt consolidation preying on the financially reckless, vulnerable and so on - as if anyone in this world would be stupid enough to sign up to anything with no prior knowledge on a cold call. If you see this number disconnect or let it ring out, nothing to be gained.
Scammer purporting to be from BT
no one there.
SCAM they call and say it is HM revenue ans put pressure on you. In one scenario they say you haven't decmare your taxes for the last few years there for you have to pay an amout of many. ( i have been asked to pay 4300 pounds for 4 years of not declaring my income) Please be aware and don't give any details of your bank. Always ask for a claim in writing and make sure they are who they say they are. If in doubt call back not on the number you been called from but to an official number of the service.
I had call from the above number guy with an indian accent, hard to understand ntold me he was BT and having trouble with internet I said no i m not bt nHe siad ok your sky nI ...
The number is a digit too short to be a valid UK number.
SCAM bullshit about being arrested for tax fraud
SMS calming to be from Lloyds saying "A payment was attempted from a NEW DEVICE on 31/03 at 15:25:16. If this was NOT you, please visit https://Lloyds.actions-device.com" Looks highly dodgy!
American recorded voice told me that I had had a law suit filed against me. Asked me to press 1 to contact my case officer. Obviously I did not do so. Obvious scam.
SCAM
"We believe you have been involved in a car accident that was not your faulT
SCAM / SPAM
twice they have called me and just hung up when I answered
Sainsburys chief executive office in Widnes but starts 0207 695 8900. Very helpful if have a problem re sainsburys or argos
Cold calling PPI company. Don't bother answering or calling back.
brabners stuart llp liverpool
eska international birmingham birmingham
Called ,one ring then hung up. Anyone else had this happen on this number
Just caled from this number..dont know it didnt answer..checked and blocked..28th jan.9.15am...
site testing services ltd altrincham altrincham
apex solutions glasgow
Silent call. Call cut immediately I answered.
London
they call me at least twice a day from all different numbers but as yet I have not answered any of them as they are from a debt that was about ten years ago which is past the statute of limit
the caller(female Indian) rang asking what washing machine I used. I put the phone down. The phone range again a while later but I did not answer it, the it rang again. This time an Indian male asked what washing machine I used. I told him I did not take cold calls and put the phone down.
SCAM pretending to be HMRC "if you do not press 1 to be connected to an operator then a warrant will be issued and you will be arrested shortly"
ppi scam
Manchester
called very early blocked
Worcester
Bacup
PPI call according to message on my house answer phone. If they call me again they will appear on my display as SPAM-29 (I am up to -36 on my mobile!)
3tee solutions ltd london london
damascus audio manchester n a
Mark Ali, Scammer, Private Harley Street Clinic, Scam Clinic
felicity callard london xx
This number calls me all the time.
Code is for Hungerford ~ Accented (Indian) male purporting to be 'Sky 'services' wanting to "speed-up my Internet service" by entering his quoted details into my PC ~ no doubt to access my financial details.... Noises of .'busy call centre' in the background ~ which can be a recording overplaying - On fact, plausible but when I didn't bite 'accepting my "slow-speed internet" ~ he gave up too easily. BEWARE.
Suppose to be carphone warehosue calling regarding a deal for the current phone you have. I have never given my number to them so I believe it s a scam.
Hung up when I answered.
London
Bridgend
Local energy provider called chriss, line went dead with in seconds. He's not a local to my location. Most likly Spam.
Scam about being in a car accident.
Please take me off your mailing list. I do not want to recieve these calls
Lytham St. Annes
Nottingham
The overall rating for phone number 08007590420 is Neutral
Said they were HMRC, block if they call
noise shape lab birmingham wmd
Rang me, didn't say anything, then hung up. Spam call.
This is one of many numbers (although many come up as Private Number) that I keep receiving calls from in the same vein as others on here. 10 calls in the last 24 hours. Ha...
When I answered the caller could be heard in the background not speaking. After around 3 secs the caller hung up. Very strange.
Automated call said they were amazon. I know this to be spam.
pro production services ltd church crookham fleet ham
jjnki
0801747767 SMS
Accident Insurance scam. Somehow they are able to have a 'local' number displayed on caller ID. Ask them for their address and correct phone number as you wish to repo...
Redruth
It’s B&Q Erdington
Some legal company (most prob PPI)... RUDE Scouse man!
HUDDERSFIELD
Oxford
london
john witt bristol avon
Bridgwater
SCAM
send one hundred pound to chichi,at flat 1,18 apoeso street,iyana ejigbo.lagos.I also want you to send three hundred pounds to uncle Aliku s elder daughter,i was sitting facing her,while she was busy cutting the cow,we ate during my father s funeral,with female clothings including panties,worth five hundred pounds,who lives with her mother at umuechi quarters,abbi,ndokwa local government,delta state.I also want you to finance a new building at umuechi quarters,through uncle williams enuma,who also dwell in
London
future voices ireland derry northern ireland
Isleworth
SCAM
WEST BROMWICH
Pont-Y-Clun
fair priced funerals ltd mellor
kola adebayo grays grays
Slough
Cardiff
London
pie enterprises ltd london london
Fraud
SPAM
none liverpool liverpool
Hull
No one responds, think its spam
SCAM / SPAM Prerecorded message claiming "a criminal case has been registered against your name". Did not listen to the remainder of the message and hung up as this is clearly a scam.
SCAM
CHRISTCHURCH
Yes, I too had a call from this number claiming to be TalkTalk. Put phone down.
kind of background noise but nobodys talking.. and call a couple times later
best of suffolk woodbridge suffolk
SCAM
Scam said they were from bt and unusual activity on my phone line. Asked to start pressing numbers but I hung up
Several missed calls from this Manchester number, with no message left. Many of the calls "after hours" i.e after 7pm. I don t know anyone in the Manchester area, also if it was a genuine call a message would be left. So in my opinion, this must be a scam call, as no message is ever left and many of the calls are before 9am and after 7pm. Annoying to say the least, these companies should be fined and banned.
Bank/Lonas
Silent call
I have 3 charges of 35pence on my phone Bill I know I didn’t ring this number. It’s an old bill so I don’t know what kind of call it was.
Second call from Manchester this week.No idea who it is.
I don't answer unknown numbers, and they didn't leave a message