7948778352 (07948778352)
Who called me from phone number 7948778352
Who called me from 7948778352
Phone number 7948778352 it's a mobile number from the EE network. This phone number has been searched 1 times. The first search was on 2026-02-16 08:36:32 and the last on 2026-02-16 09:37:32. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
7948778352 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+44
Phone number 7948778352 - 0 opinions
Reviews for phone number 7948778352
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 7948778352
QR Codes for number +44 7948778352




Phone number 7948778352 (+447948778352)
This number was searched 1 times
First date of search: 2026-02-16 08:36:32
Date of last check of this number: 2026-02-16 09:37:32
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 538778497
A similar number: 794877200, 794877554, 794877364, 79487712, 796377835, 796377835, 798577835, 792477835(79 48 77 200,79 48 77 554,79 48 77 364,79 48 77 12,79 63 77 835,79 63 77 835,79 85 77 835,79 24 77 835)
Previous phone numbers: 7948778351 7948778350 7948778349 7948778348 7948778347 7948778346 7948778345 7948778344 7948778343 7948778342 7948778341 7948778340 7948778339 7948778338 7948778337 7948778336 7948778335 7948778334 7948778333 7948778332 7948778331 7948778330 7948778329 7948778328 7948778327 7948778326 7948778325 7948778324 7948778323 7948778322 7948778321 7948778320 7948778319 7948778318 7948778317 7948778316 7948778315 7948778314 7948778313 7948778312 7948778311 7948778310 7948778309 7948778308 7948778307 7948778306 7948778305 7948778304 7948778303 7948778302 7948778301 7948778300 7948778299 7948778298 7948778297 7948778296 7948778295 7948778294 7948778293 7948778292 7948778291 7948778290 7948778289 7948778288
Next phone numbers: 7948778353 7948778354 7948778355 7948778356 7948778357 7948778358 7948778359 7948778360 7948778361 7948778362 7948778363 7948778364 7948778365 7948778366 7948778367 7948778368 7948778369 7948778370 7948778371 7948778372 7948778373 7948778374 7948778375 7948778376 7948778377 7948778378 7948778379 7948778380 7948778380 7948778381 7948778382 7948778383 7948778384 7948778385 7948778386 7948778387 7948778388 7948778389 7948778390 7948778391 7948778392 7948778393 7948778394 7948778395 7948778396 7948778397 7948778398 7948778399 7948778400 7948778401 7948778402 7948778403 7948778404 7948778405 7948778406 7948778407 7948778408 7948778409 7948778410 7948778411 7948778412 7948778413 7948778414 7948778415 7948778416 7948778417 7948778418 7948778419 7948778421 7948778421 7948778422
(Previous phone numbers: 07948778351 07948778350 07948778349 07948778348 07948778347 07948778346 07948778345 07948778344 07948778343 07948778342 07948778341 07948778340 07948778339 07948778338 07948778337 07948778336 07948778335 07948778334 07948778333 07948778332 07948778331 07948778330 07948778329 07948778328 07948778327 07948778326 07948778325 07948778324 07948778323 07948778322 07948778321 07948778320 07948778319 07948778318 07948778317 07948778316 07948778315 07948778314 07948778313 07948778312 07948778311
Next phone numbers: 07948778353 07948778354 07948778355 07948778356 07948778357 07948778358 07948778359 07948778360 07948778361 07948778362 07948778363 07948778364 07948778365 07948778366 07948778367 07948778368 07948778369 07948778370 07948778371 07948778372 07948778373 07948778374 07948778375 07948778376 07948778377 07948778378 07948778379 07948778380 07948778380 07948778381 07948778382 07948778383 07948778384 07948778385 07948778386 07948778387 07948778388 07948778389 07948778390 07948778390 07948778391)
+44 07948778352 reviews
Add your opinion about +447948778352
UK 7948778352
white pages reverse phone number lookup
Who called from number 7948778352
You can rate other simmilar phone numbers searched in our database
| 7948781235 | 7948764611 | 7948766693 |
| 7948764018 | 7948220307 | 7948394497 |
Random searched phone numbers
| 525 082 4423 | 393 095 1545 | 828 984 5795 |
| 348 807 8470 | 908 769 6044 | 682 954 3499 |
Top rated phone numbers
7534277603 Fraud8000554743 He said call was about accident claim Scam
7702874906 howard richards bromley kent
7939655823 SCAM
7762882404 jeges silk hove england
7508969235 London
2072192255 Silent call
1689814453 Indian sounding gentleman claiming that my BT broadband was dropping in and out and recieving error codes I explained I was with Sky broadband and my broadband was working just fine and they hung up
1515484086 Liverpool
6383681055 Positive number
1329734948 Has called me many times over past couple of months don039t know who they are Never leave a voice mail very annoying Will block if they call again and do the same
7904412501 SCAM SPAM
3308084562 Received txt from 01908 238013 asking me to call 03308 084 562 with a reference No saying Id set up a payment for Mrs C Davidson 850 scheduled for today 20022022 1915 Txt came in 1607Info from- httpwwwcall-chargescouk03308-premium-rate-phone-numbersoneCalls from landlines are typically charged between 2p and 10p per minute calls from mobiles typically cost between 10p and 40p per minute but they can set the rate at whatever they likeJust delete it Dont call them back
2882247318 Omagh
2072432701 the callerfemale Indian rang asking what washing machine I used I put the phone down The phone range again a while later but I did not answer it the it rang again This time an Indian male asked what washing machine I used I told him I did not take cold calls and put the phone down
7825214012 falkirk
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
7767663322 n a gullane east lothian
8437240974 Cambs 1100am 23rd Mar 2015
1918160840 This number has called me at least 4 times a day for the last four days Because I don t know the number I don t answer
7595918220 west ham united news exeter devon
7492421039 marius popa basildon essex
2081440510 Called and hung up after a long silent pause tried calling number back over ten times but did not answer SCAM
7874267745 Fraud
1206592027 SCAM
8000234540 call from 08000234540 08000234540 I had a call from this number today was RBS fraud team It was genuine I had a text message too which was also from them
9159783737 najuka k
7538844420 impact learning rickmansworth hertfordshire
7850415215 Doncaster
3331550025 Absolute fg bunch of ck sucking fg as Yes I believe that sums up my feelings adequately
Number popularity chart 7948778352
Your opinion about telephone number 7948778352 (794 877 8352)
Reverse Phone Number Search: Add your opinion about this phone number, maybe you know who called from number 7948 778 352? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. White pages reverse phone number lookup. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 079 48 77 835) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 07948778352 07948-778-352
+447948778352 |
00447948778352 |
7948 778 352 |
79 48 77 835 2 |
794 87 78 35 2 |
79-48-77-835 2 |
0044 7948-778-352 |
00 44 794 87 78 352 |
(+44)7948778352 |
79 48 77 835 2 |
(79) 4877 835 2 |
00 44 (79)4 87-78-35-2 |
+447948778352 In words... 794 877 8352
seven thousand nine hundred forty eight seven hundred seventy eight three hundred fifty two |
seven billion nine hundred forty eight million seven hundred seventy eight thousand three hundred fifty two |
Possible number records of 7948778352
Last rated phone numbers
7359340657, 7359828840, 7942051543, 7368306262, 7359825615, 2922640201, 4917655756277, 212646663105, 2031371870, 7477172814, 2922711579, 7768210969, 1758265326, 7518173234, 19095701903, 1324232041, 7893, 1202933184, 2922641913, 7588685354, 35722032305, 1156610601, 1135127671, 3330459521, 330459561, 1135190879, 8445301538, 353877821258, 7801476318, 7445742398, 63366, 8000113312, 7473168971, 7763449748, 8659732684, 7552273486, 2039365022, 2039365021, 2039365021, 2039365022, 1515561109, 2039365022, 2039365022, 2039365022, 8451340019, 4915172166153, 7479929342, 2039365022, 1782890924, 1143603919,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985040218
- Pageviews today : 498228
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
7948778352
+447948778352
SALTBURN-BY-THE-SEA
Derby
This company called and tried to take advantage of my 77 year old mother. When I rang to complain they hung up on me and when I called back and spoke to a manager, he was and I quote "I don t care what your think" Extremely unprofessional in the way they dealt with me and my complaint
music and me arbroath ans
Scam
This number keeps calling about an amazon account asked them to stop calling but it continues sometimes several times a day along with different numbers
had missed call from this number im on payasyougo phone no credit to ring back just wonder who it might be
agricair world wide ltd towcester
It's a scam or virus
Silent call
01583 364051 this number called me. I answered somebody laughed and said yes then hung up! Guess what I've now blocked there number!
SCAM, Called to my mobile and knew my first name. Asked me how my trading was going? I asked where they were calling from and they said from the monitoring department. When pushed from what company didn't give an answer. They were obviously trying to get any useful information out of me. I hang up. 4/2/21
London
Car harassment. Do not answer
indexingbase belfast northern ireland
classic vehicle solutions horsham
lanemorris oxford oxford
SCAM / SPAM Say they have PPI payment for us. Wanting us to get a paysafe card to pay their fee, they will bring a cheque to our address!
Same here. Don t know how they got my number
SCAM called about HMRC pending action...nothing to do with us
Scan !!!!!!!!
The overall rating for phone number 03334432823 is Harassing
Positive number
Scam call about some tax fraud allegation
This is one of many numbers (although many come up as Private Number) that I keep receiving calls from in the same vein as others on here. 10 calls in the last 24 hours. Ha...
Utilities They said they were from BT. Starting asking about my internet. Asked if I had given my password to anybody other than family as during the times of midnight to 2am there has been unusual activity. All sounds a bit dodgy. I hung up at that point.
no one answers when you pick up phone
This number calls me all the time.
Telemarketing
Almost certainly fraudulent as recorded message from my unspecified bank about 2 purported transactions to Amazon and another international one
Phone rang and automated voice said this is a call for (my name) if you can take the call press 1. Then it went to hold music. Then a guy answered from CARS and said hello and asked for the first line of my address. I asked who the company was and why they needed my address. He said it was for security. I said I wasn t giving details until they told me why. They said a business associate of mine had passed on my details. I asked who. He told me he needed to go through security with me before he could give m
Told me that my national insurance number will be suspended due to fraudulent activity. Its a SCAM
Telemarketing
dont give details to scammers
Didn't answer but a call from this number left a voicemail. The message was pre-recorded, spoken in Chinese and claiming to be from DHL. Scam.
pie enterprises ltd london london
+998993123340
Wrexham
goldfinch marketing wantage oxfordshire
Just hung up when I answered.
Henley-In-Arden
SCAM
I didn't answer, but Phil was probably correct. Straight to my reject list.
CHESTER
ventech systems brentford middlesex
ccv ealing broadway middlesex
edward east wadebridge cornwall
Ambulance chaser
SCAM - Fake HMRC bog standard ' you owe money or will be arrested '. OK......
london
as above several missed calls, goggled and found above
It was a recruiter from Booking.com. Seemed like a nice guy and was able to give me some useful info.
london
Reported as a telemarketer
Courier
SCAM
ben dunlop oxted oxted
HEALTH INSURANCE - SALES CALL
SPAM
Gsjwywgx
Fraud Claim to be HMRC for a tax fraud case
Called me about cryptocurrency for some reason, and I'm not even british
east anglian land surveys ltd stowmarket suffolk
SCAM
anaeko interactive limited gloucestershire
missed the call. I do not have contacts in Gera so it is a spam call and is now blocked
Information
London
They phoned me in January, February, March, April and today 1st of May 2018 ! lol Problem been their phoning an old dead number of mine, calls are logged (recorded) and any txt messages are forwarded to my new number. No web link or virus can be transferred to my new mobile yawn. Some times I miss the thrill of having to fight a virus on the old mobile "NOT" lol The old sim is NOT even in a mobile phone. I check it now and again (1471) just in case I have won millions or a car or a T.v Yawn! don t you just
A guy with an Indian accent called from this number, wanting to sell me an iPhone...but then he tried to have phone sex with me. I'm a guy, by the way. He wanted me to suck his dick, wanted to fuck me...I think the call only ended because his supervisor intervened. I swear, these call centre guys are a bunch of pervs!
jason bevan pontypridd cardiff
SCAM / SPAM
Fraud
Called an asked my name immediately. As as soon as as I said whose calling they hung up. They didn t identify themselves either. Tip: don t answer to your name just ask whose calling before speaking to them.
Returned call to a number that sounded like it was a dead line. Probably a scam
made easy concepts-domain for sale sketty swansea
matthew wilson belfast xx
Asked to speak to me, so suggested wrong number - asked again, then hung up.
Telemarketing
London
rjp asset management leamington spa war
My wife received a voice mail saying that "you have a serious file against your name, you will face hard and unwanted legal consequences" no names were mentioned. Wife found it quite disturbing. Scam call told her to delete.
Fraud
bdsa london sports day london
telling you you have a problem with your computer.
No answer cold calling
Courier
myoxygen ltd bristol avon
planet hub ltd belfast northern ireland
Scam call. Supposed to be from Amazon
Barnet
Code is for Hungerford ~ Accented (Indian) male purporting to be 'Sky 'services' wanting to "speed-up my Internet service" by entering his quoted details into my PC ~ no doubt to access my financial details.... Noises of .'busy call centre' in the background ~ which can be a recording overplaying - On fact, plausible but when I didn't bite 'accepting my "slow-speed internet" ~ he gave up too easily. BEWARE.
anod gurung morden surrey
laverigifts london greater london
penrhyn pre-school walthamstow london
A company keeps calling me and says they have 3 questions... i tell them the details they have for me are incorrect. they hang up as soon as i challenge anything
bigspring (uk) ltd nottingham nottinghamshire
Anglian Home Improvements or whatever they're called. I had a quote from them ages ago but they're still persisting even though I had blocked them from another number they were using when I said I was not looking to go ahead. Borderline harassment the amount they call.
The overall rating for phone number 08000128025 is Dangerous
Phone to abuse