97669884 (097669884)
Who called me from phone number 97669884
Who called me from 97669884
Phone number 97669884 it's a mobile number from the unknown network. This phone number has been searched 1 times. The first search was on 2026-02-16 08:34:56 and the last on 2026-02-16 09:35:56. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
97669884 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+44
Phone number 97669884 - 0 opinions
Reviews for phone number 97669884
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 97669884
QR Codes for number +44 97669884




Phone number 97669884 (+4497669884)
This number was searched 1 times
First date of search: 2026-02-16 08:34:56
Date of last check of this number: 2026-02-16 09:35:56
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 48896679
A similar number: 976698629, 976698852, 976698950, 976698439, 97309884, 97309884, 97559884, 97549884(97 66 98 629,97 66 98 852,97 66 98 950,97 66 98 439,97 30 98 84,97 30 98 84,97 55 98 84,97 54 98 84)
Previous phone numbers: 97669883 97669882 97669881 97669880 97669879 97669878 97669877 97669876 97669875 97669874 97669873 97669872 97669871 97669870 97669869 97669868 97669867 97669866 97669865 97669864 97669863 97669862 97669861 97669860 97669859 97669858 97669857 97669856 97669855 97669854 97669853 97669852 97669851 97669850 97669849 97669848 97669847 97669846 97669845 97669844 97669843 97669842 97669841 97669840 97669839 97669838 97669837 97669836 97669835 97669834 97669833 97669832 97669831 97669830 97669829 97669828 97669827 97669826 97669825 97669824 97669823 97669822 97669821 97669820
Next phone numbers: 97669885 97669886 97669887 97669888 97669889 97669890 97669891 97669892 97669893 97669894 97669895 97669896 97669897 97669898 97669899 97669900 97669901 97669902 97669903 97669904 97669905 97669906 97669907 97669908 97669909 97669910 97669911 97669912 97669912 97669913 97669914 97669915 97669916 97669917 97669918 97669919 97669920 97669921 97669922 97669923 97669924 97669925 97669926 97669927 97669928 97669929 97669930 97669931 97669932 97669933 97669934 97669935 97669936 97669937 97669938 97669939 97669940 97669941 97669942 97669943 97669944 97669945 97669946 97669947 97669948 97669949 97669950 97669951 97669953 97669953 97669954
(Previous phone numbers: 097669883 097669882 097669881 097669880 097669879 097669878 097669877 097669876 097669875 097669874 097669873 097669872 097669871 097669870 097669869 097669868 097669867 097669866 097669865 097669864 097669863 097669862 097669861 097669860 097669859 097669858 097669857 097669856 097669855 097669854 097669853 097669852 097669851 097669850 097669849 097669848 097669847 097669846 097669845 097669844 097669843
Next phone numbers: 097669885 097669886 097669887 097669888 097669889 097669890 097669891 097669892 097669893 097669894 097669895 097669896 097669897 097669898 097669899 097669900 097669901 097669902 097669903 097669904 097669905 097669906 097669907 097669908 097669909 097669910 097669911 097669912 097669912 097669913 097669914 097669915 097669916 097669917 097669918 097669919 097669920 097669921 097669922 097669922 097669923)
+44 097669884 reviews
Add your opinion about +4497669884
UK 97669884
01179 area code
Who called from number 97669884
You can rate other simmilar phone numbers searched in our database
| 97664234 | 97667832 | 97666388 |
| 97666674 | 97673249 | 97633953 |
Random searched phone numbers
| 120 384 1939 | 520 575 2362 | 516 623 9824 |
| 290 628 7179 | 691 125 2600 | 836 899 4303 |
Top rated phone numbers
7551125214 boston7842514243 SCAM
8454133898 ambulance chasers also trying to get personal info They hung up when I started asking where they got my telephone number from
9957773401 Private number
77949853234 SCAM
7832649775 Safe number
7701049505 portadown
2083327227 SPAM one of many numbers to call me which are apparently some random shops around the UK like premier sainsburys and a Turkish restaurant Now this Apparently a newsagents I think its someone spoofing using their numbers to scam people
7939655823 SCAM
1746541034 SCAM - caller claimed to be from Virgin Media I couldnt be bothered to string them along like I usually do instead I just blew my emergency whistle into the microphone
2896245300 Thank you Google I almost got scammed from 289-624-5300 289-624-4285 647-354-2063 I was about to call this person for a list of software programs that I wanted for my home and new business office and I noticed that this seller was in Toronto Yes So I was happy about what he had to sell because I wanted these programsand my 14 year daughter said she had a bad feeling about this software guy However my daughter kept begging me and bugging me to Google search this number - 289-624-3
1613549654 Call at 935 AM purporting to be from Talktalk informing me of errors on my computer getting me to look at the quite normal errors in event viewer and saying they need to be
2072894049 London
7985191539 dhj legal miskin
1224572706 david cruickshank aberdeen xx
1237200660 Gent Spike but sounded foreign from Benefits UK said he wanted to ask some questions I was expecting a call and needed to keep the line free He hung up while I was politely explaining this so I think the call is suspect
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1343811378 Lossiemouth
1333661578 Scam call Supposed to be from Amazon
1604768537 Northampton
17953222222 It039s a scam or virus
7940396018 Automated call Robotic voice mimicking a human male voice Claimed to be Amazon customer service
63366 IF you really need a professional hacker to make hacking service for you I would recommend UNLIMITEDWEBHACKERSGMAILCOM to improve credit worthinessDo you need hacking services Do you face delays and unnecessary excuses from fake hackers in your work Dont worry anymore because we are the best hackers alive Which hacking service do you need We can do it with an immediate response and your work is 100 guaranteed without delayOur services include the following and moreampquotUniversity g
1418811254 SCAM
2071680601 SCAM
2033753000 SCAMHMRC SCAM
2081579884 SCAM
1625324015 kind of background noise but nobodys talking and call a couple times later
1413750945 Contacted twice by text message first saying regarding BT and contact on above no quoting a ref no they had given or text BPO to 60006Second call a week later saying BPO can offer you a saving on your BT account again contact on above no etc etc
1217069546 junaid shabbir birmingham west midlands
Number popularity chart 97669884
Your opinion about telephone number 97669884 (976 698 84)
Who Is This Phone Number: Add your opinion about this phone number, maybe you know who called from number 976 698 84? Maybe it's yours phone number and you can comment on it. Please rate if this phone number is secure and you can pick up this phone. If someone called you from this phone number, someone called or sent you some paid SMS, please add your opinion on our website. 01179 area code. Do not keep the information who called only for myself. Share the description and your opinion on the description of your experience with this number phone, use our form and help other our users. Please rate this phone number (+44 097 66 98 84) is it a secure number and you can answer the call. Thank you for yoursreviews.
Possible number records of 097669884 0976-698-84
+4497669884 |
004497669884 |
976 698 84 |
97 66 98 84 |
976 69 88 4 |
97-66-98-84 |
0044 976-698-84 |
00 44 976 69 88 4 |
(+44)97669884 |
97 66 98 84 |
(97) 6698 84 |
00 44 (97)6 69-88-4- |
+4497669884 In words... 976 698 84
nine seven six six nine eight eight four zero |
ninety seven sixty six ninety eight eighty four zero |
Possible number records of 97669884
Last rated phone numbers
2475901471, 1172054793, 7772529358, 7751132922, 7712933177, 7724896633, 3330456786, 7733850572, 7733850572, 2045251410, 63366, 7473520447, 7369285599, 7554414092, 1223447532, 3303413407, 1482293843, 7778399189, 7448633179, 7545437254, 7448073974, 7902860110, 7466888519, 7763485701, 2080972460, 7745268386, 7799148002, 7974638469, 7716579373, 7878965412, 7538713161, 7939237011, 7536211388, 7545167386, 7527929999, 7745268386, 7536211388, 7742665280, 7512602075, 7728320673, 7545437254, 7466888519, 7728320673, 1243553951, 2037691834, 7709595718, 2922722090, 7964986532, 7359860140, 1644216392,Who's called me uk
Who visited this number
| Nr | Country | Area | Provider | Ip |
|---|---|---|---|---|
| 1 | New Zealand | Auckland | Spark New Zealand Trading Limited | 125.237.211.xx |
Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985038789
- Pageviews today : 496799
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
97669884
+4497669884
I had call from the above number guy with an indian accent, hard to understand ntold me he was BT and having trouble with internet I said no i m not bt nHe siad ok your sky nI ...
Fraud
Gsjwywgx
andrew ashworth southport merseyside
Silent call
auto-art ltd shotts lanarkshire
who called me from this phone numer?
andrewaz and associates newcastle upon tyne nbl
Sex Video Call case
SCAM, phishing call
straight scammers its an old scam - they claim to be service provider..tell that your computer is infected and its affecting "their servers" (sometimes they will navigate you to very unimportant "event viewer" warnings within your system, to try and "prove" this to you!!).. then try to have you download software that enables them to control you computer,and(or)have you download free antivirus then try to charge you. i have sometimes played along... as soon as they realize you are onto them - they will s
Rotherham
Rang saying they were from Sky and asking about a problem with our internet. I hung up
Scam call. Supposed to be from Amazon
Robotic voice say thank you for order placed from amazon saying I have been charged
call from 08000234540 08000234540 I had a call from this number today, was RBS fraud team. It was genuine. I had a text message too which was also from them.
Stef defo works for them lol mug
Anglian Home Improvements or whatever they're called. I had a quote from them ages ago but they're still persisting even though I had blocked them from another number they were using when I said I was not looking to go ahead. Borderline harassment the amount they call.
SCAM, Called to my mobile and knew my first name. Asked me how my trading was going? I asked where they were calling from and they said from the monitoring department. When pushed from what company didn't give an answer. They were obviously trying to get any useful information out of me. I hang up. 4/2/21
Edinburgh
Strange to have a phone call in Wales from Scotland when never been there. Can BT stop them.
SPAM
Thought she had given up but she called again today. This time I flatly refused to put her call through due to insufficient information. She is now getting a senior manager to ring me. Bring it on .....
Paisley
BIRMINGHAM WEST MIDLANDS
I’ve had a spate of calls this week. Here are the numbers: n01628 435057 Maidenhead n01585 143765 UK n01089 669067 UK n01361 962860 UK n01287 923999 UK n0121 539 8559 Birmingha...
Continually ringing, havent answered, interested if anyone else has been contacted
Phonepe customer care number 7605852409==7645922878
Text to say mum run out of battery and I’m using my friend phone call me on my new number
SCAM
Scam
London
Missed call
Courier
Safe number Great Ormond Street children's hospital charity. conformation phone call about donation. Expected phone call.
portadown
Private number
aquien pertenese
The overall rating for phone number 01513758120 is Harassing
Cold call from telemarketing company based in Manchester claiming to be 02 Partner. Told to fxxk xff and not call me again. Also blocked number on phone but my call logs showed they continued to ring me. Pig stupid or what.
Harassment call ,they queep calling and don t speak
tru-green selby yorkshire, north riding
Local Taxi firm.
I don,t know this number
London
SCAM - automated HMRC message
Private number
Ipswich
Southampton
Chris, my local energy adviser, calls every day. I have asked for my number to be removed from their list. His response ? No.
Fraud
It's safe
Manchester
my fairy godmother ipswich sfk
Fraud I am selling a car in Czechia, this number contacts me and is interested in buying. Says he's in Belgium, that his mother is from UK and father from Belgium. He did not speak very good English and had no French accent either. He repeated several times that he'd send me money for the car in advance and send a private shipping company afterwards. Photos on a Czech ad site were apparently enough. When I was insisting on a face to face meeting, the call abruptly ended. Be careful!!!
fitness matters st. helens msy
c o blue soap manchester
Yet another annoying recorded message regarding a repayment scheme for a loan!
SPALDING
just had recorded message on this number saying its cyber internet security ,,and will disconnect my internet in 20 mins ,push 1 to solve this ,no way didnt do it .BEWARE
Something called choosy rang me twice, waited until I picked it up then rang off both times, it is very annoying and probably a scam, block the number if you can
made easy concepts-domain for sale sketty swansea
ranjeet rana peacehaven east sussex
London
I got a call from this number which I missed. I called the number back and heard a recorded message saying it was a company called Ascend Finance. I googled it and found it is a...
SCAM Pretending to be HSBC
told me he was a technical support team and they c i have trouble with my windows on my computer. i told him i have no computer .u don't was his reply and he dropped the ...
London
andrew goyns normanton west yorkshire
Fraud
SCAM Fake mobile contract facilitator, I didn't go this far because I'm not an idiot but they will "accept" your application for a mobile phone contract and will request a deposit and the first month upfront, to then not send your device but still take monthly payments.
SCAM / SPAM Mobile message purporting to be from HMRC with a rebate.
Unknown caller - recorded message
WIRRAL
samuel koranteng-asare tilbury thurrock
ldn-partners cheshunt herts
semper aesthetics cleethorpes
luminata ltd london ealing
Scam scam scam
01728605684 Unseriös - Vorsicht! Herr Toussaint gibt M&A-Deal vor
guy montrose bournemouth dorset
Report this company to the ICO immediately. It is the only way to stop these calls.
black dog clinic london n a
SCAM / SPAM
London
Missed calls, called back to automic machine, stella UK, tprobably sold by Vanquis bank. Do not answer or give information. PUT THEM ON HOLD BY PLAYING LOUD ROCK MUSIC DOWN THE PHONE!!! :D :D
01583 364051 this number called me. I answered somebody laughed and said yes then hung up! Guess what I've now blocked there number!
Fraud
answered a phone call but it wasn't very clear what they said then it went silent so i hung up and called back it went straight to voice mail - which was american, saying t...
berkshire
Asked to speak to someone that wasn t me .told them so and hung up. Asian sounding gentleman, possible scam handle with care
nigelclark cheltenham gloucestershire
Fraud
Silent call
It was an accident hoax, car accident in the past
London
Positive number
Energy saving switch line, cold caller / bot caller
This is NOT a trustworthy caller. They are pretending to be a Windows Technical Centre. It is a SCAM. (Re-reported as I misunderstood the rating previously)
olaf hoeg ltd. eastbourne east sussex