1162844528 (01162844528)
Who called me from phone number 1162844528 Leicester
Who called me from 1162844528
Phone number 1162844528 it's a landline number from Leicester. This phone number has been searched 1 times. The first search was on 2026-02-16 08:33:40 and the last on 2026-02-16 09:34:40. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1162844528 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+44116
Phone number 1162844528 - 0 opinions
Reviews for phone number 1162844528
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1162844528
QR Codes for number +44 1162844528




Phone number 1162844528 (+441162844528)
Country: United Kingdom
Country code: +44 (0044)
City: Leicester
Directional local: 116 (0116)
Code: 44116 (0044116)
This number was searched 1 times
First date of search: 2026-02-16 08:33:40
Date of last check of this number: 2026-02-16 09:34:40
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 254482611
A similar number: 116284170, 116284720, 116284516, 116284893, 112384452, 112384452, 118484452, 118184452(11 62 84 170,11 62 84 720,11 62 84 516,11 62 84 893,11 23 84 452,11 23 84 452,11 84 84 452,11 81 84 452)
Previous phone numbers: 1162844527 1162844526 1162844525 1162844524 1162844523 1162844522 1162844521 1162844520 1162844519 1162844518 1162844517 1162844516 1162844515 1162844514 1162844513 1162844512 1162844511 1162844510 1162844509 1162844508 1162844507 1162844506 1162844505 1162844504 1162844503 1162844502 1162844501 1162844500 1162844499 1162844498 1162844497 1162844496 1162844495 1162844494 1162844493 1162844492 1162844491 1162844490 1162844489 1162844488 1162844487 1162844486 1162844485 1162844484 1162844483 1162844482 1162844481 1162844480 1162844479 1162844478 1162844477 1162844476 1162844475 1162844474 1162844473 1162844472 1162844471 1162844470 1162844469 1162844468 1162844467 1162844466 1162844465 1162844464
Next phone numbers: 1162844529 1162844530 1162844531 1162844532 1162844533 1162844534 1162844535 1162844536 1162844537 1162844538 1162844539 1162844540 1162844541 1162844542 1162844543 1162844544 1162844545 1162844546 1162844547 1162844548 1162844549 1162844550 1162844551 1162844552 1162844553 1162844554 1162844555 1162844556 1162844556 1162844557 1162844558 1162844559 1162844560 1162844561 1162844562 1162844563 1162844564 1162844565 1162844566 1162844567 1162844568 1162844569 1162844570 1162844571 1162844572 1162844573 1162844574 1162844575 1162844576 1162844577 1162844578 1162844579 1162844580 1162844581 1162844582 1162844583 1162844584 1162844585 1162844586 1162844587 1162844588 1162844589 1162844590 1162844591 1162844592 1162844593 1162844594 1162844595 1162844597 1162844597 1162844598
(Previous phone numbers: 01162844527 01162844526 01162844525 01162844524 01162844523 01162844522 01162844521 01162844520 01162844519 01162844518 01162844517 01162844516 01162844515 01162844514 01162844513 01162844512 01162844511 01162844510 01162844509 01162844508 01162844507 01162844506 01162844505 01162844504 01162844503 01162844502 01162844501 01162844500 01162844499 01162844498 01162844497 01162844496 01162844495 01162844494 01162844493 01162844492 01162844491 01162844490 01162844489 01162844488 01162844487
Next phone numbers: 01162844529 01162844530 01162844531 01162844532 01162844533 01162844534 01162844535 01162844536 01162844537 01162844538 01162844539 01162844540 01162844541 01162844542 01162844543 01162844544 01162844545 01162844546 01162844547 01162844548 01162844549 01162844550 01162844551 01162844552 01162844553 01162844554 01162844555 01162844556 01162844556 01162844557 01162844558 01162844559 01162844560 01162844561 01162844562 01162844563 01162844564 01162844565 01162844566 01162844566 01162844567)
+44 01162844528 reviews
Add your opinion about +441162844528
UK 1162844528
best value android phone
Who called from number 1162844528
You can rate other simmilar phone numbers from Leicester, searched in our database
| 1162854988 | 1162840252 | 1162839604 |
| 1162319339 | 1162298182 | 1162557580 |
Random searched phone numbers
| 848 213 1465 | 910 782 9567 | 977 390 4164 |
| 689 894 6902 | 988 757 5235 | 978 324 8652 |
Top rated phone numbers
1726427897 answered a phone call but it wasn039t very clear what they said then it went silent so i hung up and called back it went straight to voice mail - which was american saying t2039917082 SCAM
7702616148 mark gogle wolverhampton west midlands
3454541111 The overall rating for phone number 03454541111 is Neutral
7738083179 luminata ltd london ealing
8979047447 Who number is this
7562133942 SCAM SPAM Mobile message purporting to be from HMRC with a rebate
2006432785 quotOur records tells us you have a had a recent car crashquot Scam
780234495 Silent call
1383627611 vets now ltd dunfermline dunfermline
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
1163260667 calling 3 to 4 times a day they keep on asking for bank account details wont say what they want them for have blocked them on my mobile would suggest to other ppl to do the same
7772544596 SCAM SPAM
2036170960 Called my mobile ampquotHiyaampquot identified as Suspected Spam London based number Whoever it was hung up on me answeringNow blocked just because they hung up without speaking
7921803365 edward east wadebridge cornwall
1524241845 Bank Scam Call
8437240936 Asks me about a survey unsolicited calls
698359939 Positive number
7792472488 ee ltd london
2033369110 SPAM
2072432701 the callerfemale Indian rang asking what washing machine I used I put the phone down The phone range again a while later but I did not answer it the it rang again This time an Indian male asked what washing machine I used I told him I did not take cold calls and put the phone down
7802639219 BankLonas
7976048027 SALTBURN-BY-THE-SEA
7766774379 n a london london
2085311782 This number and the following number 07404235048 keeps phoning me so far 5 times today and a recorded message says that they are from BT and we have had a security breach with our phone line and broadband and that they are going to turn us off and trying to get us to press a button to respond to them We are not even with BT DONT trust these phone numbers
1707601415 charteroak estates limited potters bar hertfordshire
333214080 FirstPort property management
3003000120 Why does this number call me and not say anything
3002002645 Called pretending to be from HMRC and threatening arrest due to outstanding tax bill which I don t have
9268565450 SCAM SPAM
Number popularity chart 1162844528
Your opinion about telephone number 1162844528 (116 284 4528)
Phone Search: Check phone number from Leicester ??? Among the missed calls in saved reviews in our database by our users, you can usually meet all kinds companies and institutions such as offices, courier companies, transport companies, telemarketing, insurance companies, sales by telephone, consolidation loans, cash loans and payday loans as well as mobile telephony (Orange, T-mobile) calling us with a new offer. It is in these departments that many calls are often executable, but often after calling back on a given phone number, no one answers or We connect directly to the central where we do not know who called us. Best value android phone. In this situation, the best solution is to find an opinion on a given telephone number, to know who called us and whether we should call back or next time we answer the phone.
Possible number records of 01162844528 01162-844-528
+441162844528 |
00441162844528 |
1162 844 528 |
11 62 84 452 8 |
116 28 44 52 8 |
11-62-84-452 8 |
0044 1162-844-528 |
00 44 116 28 44 528 |
(+44)1162844528 |
11 62 84 452 8 |
(11) 6284 452 8 |
00 44 (11)6 28-44-52-8 |
+441162844528 In words... 116 284 4528
one thousand one hundred sixty two eight hundred forty four five hundred twenty eight |
one one six two eight four four five two |
Possible number records of 1162844528
Last rated phone numbers
7027000119, 2031544943, 3316301736, 2031293705, 1352756353, 7585715385, 1792722193, 7830581557, 2035144341, 1352757977, 1633603863, 7577531877, 2045870979, 1975354616, 7736701738, 7526919350, 2081356806, 1253835948, 7947801292, 7367300221, 2045870436, 7818015748, 1157911136, 1733964915, 7537159779, 7871484755, 7591956274, 7922253152, 8000211371, 2045870282, 1617288124, 1135349508, 7766880774, 7766880774, 7949282796, 7305273921, 7792284853, 7788431393, 1620895511, 1733964586, 1803605417, 1202237998, 2038301320, 1305818630, 2045869531, 1939834436, 1883348895, 391024310334, 1902421414, 1562512312,Who's called me uk
Who visited this number
| Nr | Country | Area | Provider | Ip |
|---|---|---|---|---|
| 1 | Singapore | Singapore | Huawei Cloud Service | 114.119.151.xx |
Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985037704
- Pageviews today : 495714
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1162844528
+441162844528
The person said they where from 118 live directory, he asked for the business owner which I am not so I said no I’m afraid he won’t be in untill friday at that point he hung up. I did 14713 and called back to get an automated American voice saying it was utility direct. Scam.
xeinu ltd london na
Who rang me on this number
linked too; 02030979302, 02086381096 SPAM, ignore, block
The overall rating for phone number 08082237401 is Harassing
Text Message said I was eligible for the flu jab, and to book via mygp.io app. There was a link to that app, but didn't click it. Suspect it's not genuine, but it did have my correct first name, so will go for neutral for now as I'm the first to review.
cold caller about road traffic accident. I asked which one ? and she was vague. I asked how they got my number and was told they took it off the "road traffic database"...
Dhilip
clydeside records helensburgh n a
Couple of calls received with no one on the other end.
SCAM
annan-forson enfield
Asian prat telling me he was from BT openreach advising me of a problem with my internet connection, told him not to worry about it and hung up immediately. They have tried phon...
anaeko interactive limited gloucestershire
misspooja london london
Stockton on Tees
This is NOT a trustworthy caller. They are pretending to be a Windows Technical Centre. It is a SCAM. (Re-reported as I misunderstood the rating previously)
Maidstone
Pretending to be Royal mail , is a scam be careful
Just received call from this number. Didn t answer and no message left. I rang 1471 and obtained number and rang it three times and it was a dead line.
made easy concepts-domain for sale sketty swansea
As previously stated, they call (several times a day) and then just hang up.
SCAM
Telemarketing
Barnet
claimed to be from Parcelforce, trying to rearrange a delivery. As we haven t ordered anything, it must be a scam!
I didn't pick up and no message was left. Assume this is the usual PPI or some other cold caller.
great ltd bournemouth dorset
SCAM / SPAM Robo call claiming to be HMRC fraud office
SPAM
Sent me information on buying carbon credits after me avoiding them for weeks - now they are trying to ring me 4 times a day - I just reject the call now ..... Shame I through all their stuff in the bin as I can t remember the name or address to write to stop them calling plus they never leave messages with is even more annoying !!!!
Spam
It's a scam or virus
This phone number was on a letter purporting to be from the DWP. It was threatening in the way that it said if I do not tell them all my bank accounts etc and how much I have in...
London
Claim I owe money and not with them I m with seven Trent
SCAM Repeated calls
Claim to be working for Microsoft Corporation and that you have a software problem on your computer. Can become very unpleasant when challenged, including making threats. They a...
What can I say? It was a silent call.
Finchley
Redditch
Private number
frank dehn london greater london
Someone pretending to be HMRC when called back - I wouldn't call if I was you !!
Keep ringing me and hanging up. Wish someone would do something about these people
SCAM
01255163801
called to ask if I was ready to replace boiler after contacting them...like no I will contact gas board
scammers passing themselves as HM revenue, claiming you did not pay your taxes
Private number
SCAM automated robot voice. i hung up immediately once it said 'Attention,'. block this number!
It`s a scam.
Chris, my local energy adviser, calls every day. I have asked for my number to be removed from their list. His response ? No.
+44 7858 129389 This number is being used to fetch and scamming money posing as traveler and investor
SCAM - automated voice message that said they're from Amazon and that you're account has been compromised. Load of rubbish. I don't even have an Amazon account!
called and left no message
SCAM
SCAM
planet hub ltd belfast northern ireland
Missed call from this number
eska international birmingham birmingham
Positive number
Looks like a spam call to sell you stuff. I returned the call and got through to a voice message saying that I "will be put through the next agent". I've blocked...
They hang up when I answered the call.
Cardiff
PLEASE DO NOT ANSWER CALLS FROM THIS NUMBER.....When I answered several months ago the "indian" sounding lady at the other end simply said "we are coming to your house this evening to kill you...what do you think about that?".....I put the phone down...THE POLICE are totally helpless in cases like this...apparently this company is NOT breaking any laws!!!...DO NOT ANSWER....they rang me again today which went unanswered...which proves their stupidity...but then it comes as not surprise!
marius popa basildon essex
Crewe
Lancing
donald brown banchory aberdeenshire
Automated recording trying to sell PPI mis-selling claim service, even though phone number is registered with TPS
Fraud
Scam
Phone to abuse
Fraud Automated message telling me I had an arrest warrant and to push 1 for more options
Courier
I don,t know this number
jeges silk hove england
I was called today at 4.42 by a man with a Liverpool accent. He said that his company "Claims Legal Group" worked alongside my car insurers and he wanted to talk to m...
This number has sent me a bogus text to get in contact re; a direct debit. Do not call this number!
Rochdale
said they were HMS inspector of taxes and there was an investigation against me.
bvrt london
music and me arbroath ans
Tamworth
told me he was a technical support team and they c i have trouble with my windows on my computer. i told him i have no computer .u don't was his reply and he dropped the ...
Altrincham
they said they will give a job in pune but telling me to register for rs 2000 n will offer me a job of 3-3.5lk p.a.
Hi guys.. We all keep getting these calls!! I know its annoying, illegal, upsetting, etc.. I get probably 5-10 on a daily basis, ranging from PPi, boilers, hearing aids, accidents and many more! When you tell them ur not interested, this is the worst thing you can do, because they WILL NEVER DELETE YOUR NUMBER!! They gets commissions just for contacting you!! So this is what I do now.... Accept the calls, and give them false details of ur name and address and mention u have changed ur phone number. (M
PPI nuisance call. They are based in Manchester so don't why I was called from a West Sussex number.
Courier
Fraud
01728605684 Unseriös - Vorsicht! Herr Toussaint gibt M&A-Deal vor
Fraud
Drighlington Bradford
Scam
Fraud
softwre solutions ltd london uk
durkin's scaffolding ltd watford herts
Hiii