1162867384 (01162867384)
Who called me from phone number 1162867384 Leicester
Who called me from 1162867384
Phone number 1162867384 it's a landline number from Leicester. This phone number has been searched 1 times. The first search was on 2026-02-16 08:29:10 and the last on 2026-02-16 09:30:10. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1162867384 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+44116
Phone number 1162867384 - 0 opinions
Reviews for phone number 1162867384
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1162867384
QR Codes for number +44 1162867384




Phone number 1162867384 (+441162867384)
Country: United Kingdom
Country code: +44 (0044)
City: Leicester
Directional local: 116 (0116)
Code: 44116 (0044116)
This number was searched 1 times
First date of search: 2026-02-16 08:29:10
Date of last check of this number: 2026-02-16 09:30:10
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 837682611
A similar number: 116286676, 116286130, 116286887, 11628694, 118186738, 118186738, 111186738, 119186738(11 62 86 676,11 62 86 130,11 62 86 887,11 62 86 94,11 81 86 738,11 81 86 738,11 11 86 738,11 91 86 738)
Previous phone numbers: 1162867383 1162867382 1162867381 1162867380 1162867379 1162867378 1162867377 1162867376 1162867375 1162867374 1162867373 1162867372 1162867371 1162867370 1162867369 1162867368 1162867367 1162867366 1162867365 1162867364 1162867363 1162867362 1162867361 1162867360 1162867359 1162867358 1162867357 1162867356 1162867355 1162867354 1162867353 1162867352 1162867351 1162867350 1162867349 1162867348 1162867347 1162867346 1162867345 1162867344 1162867343 1162867342 1162867341 1162867340 1162867339 1162867338 1162867337 1162867336 1162867335 1162867334 1162867333 1162867332 1162867331 1162867330 1162867329 1162867328 1162867327 1162867326 1162867325 1162867324 1162867323 1162867322 1162867321 1162867320
Next phone numbers: 1162867385 1162867386 1162867387 1162867388 1162867389 1162867390 1162867391 1162867392 1162867393 1162867394 1162867395 1162867396 1162867397 1162867398 1162867399 1162867400 1162867401 1162867402 1162867403 1162867404 1162867405 1162867406 1162867407 1162867408 1162867409 1162867410 1162867411 1162867412 1162867412 1162867413 1162867414 1162867415 1162867416 1162867417 1162867418 1162867419 1162867420 1162867421 1162867422 1162867423 1162867424 1162867425 1162867426 1162867427 1162867428 1162867429 1162867430 1162867431 1162867432 1162867433 1162867434 1162867435 1162867436 1162867437 1162867438 1162867439 1162867440 1162867441 1162867442 1162867443 1162867444 1162867445 1162867446 1162867447 1162867448 1162867449 1162867450 1162867451 1162867453 1162867453 1162867454
(Previous phone numbers: 01162867383 01162867382 01162867381 01162867380 01162867379 01162867378 01162867377 01162867376 01162867375 01162867374 01162867373 01162867372 01162867371 01162867370 01162867369 01162867368 01162867367 01162867366 01162867365 01162867364 01162867363 01162867362 01162867361 01162867360 01162867359 01162867358 01162867357 01162867356 01162867355 01162867354 01162867353 01162867352 01162867351 01162867350 01162867349 01162867348 01162867347 01162867346 01162867345 01162867344 01162867343
Next phone numbers: 01162867385 01162867386 01162867387 01162867388 01162867389 01162867390 01162867391 01162867392 01162867393 01162867394 01162867395 01162867396 01162867397 01162867398 01162867399 01162867400 01162867401 01162867402 01162867403 01162867404 01162867405 01162867406 01162867407 01162867408 01162867409 01162867410 01162867411 01162867412 01162867412 01162867413 01162867414 01162867415 01162867416 01162867417 01162867418 01162867419 01162867420 01162867421 01162867422 01162867422 01162867423)
+44 01162867384 reviews
Add your opinion about +441162867384
UK 1162867384
995 country code
Who called from number 1162867384
You can rate other simmilar phone numbers from Leicester, searched in our database
| 1162869043 | 1162838927 | 1162834174 |
| 1162680028 | 1162604655 | 1162416239 |
Random searched phone numbers
| 967 026 3321 | 749 997 9000 | 573 485 6783 |
| 215 745 2125 | 691 959 7355 | 846 006 1562 |
Top rated phone numbers
2034725122 scammers passing themselves as HM revenue claiming you did not pay your taxes7973319155 elka de wit london
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
2036381391 constantly phone both home and mobile number no message how can I stop them
1444642006 PPI nuisance call They are based in Manchester so don039t why I was called from a West Sussex number
1216677535 same here ringing everyday 5-6pm laving no message so how do i know who they are they must ly to keep trying to get hold off ppl lol other number as well is 0121 667 75343637
7860004600 3 unsolicited spam texts from this number in the past 9 days All with links to follow Don t click on their links
1472350565 nick smith cleethorpes north east lincolnshire
1517943363 university of liverpool liverpool
1293533445 vistavis limited crawley west sussex
2925194750 Silent call nuisance again
1612777345 Bogus Accident claim line- scam call Autodialled and delay response then Asian accent quotI am calling you on your accidentquot Hung up when directly questioned on wh
7944499708 SCAM SPAM
1223357901 Automated scam call pretending to be HMRC
7934332706 Numerous text messages re entitlement to compensation for the mis-selling of PPI
7876572336 SCAM
2030020931 Called and said they wanted to discuss my Vodaphone order Told them no no no no etc and they hung up
8000234540 call from 08000234540 08000234540 I had a call from this number today was RBS fraud team It was genuine I had a text message too which was also from them
3058290979 hy
7985191539 dhj legal miskin
7459679867 LONDON
1888692556 Telemarketing
1202143036 Silent call
2079461958 Phoned me 9 times over a 3 day period when I picked the number up an aggressive Pakistani man said I d had an accident and told me someone was suing me for hitting their car I told him not to call and he used the term Fk off to me then put the phone down but within the hour he had called again twiceI proceeded to say I would report him to the Police he shouted something at me and put the phone down again I had a further 4 calls in the coming days each week averaging 12 calls
1616199350 SCAM fake google ads call
3335550575 Fraud
1752851451 ucad saltash cornwall
430495307 Fraud
7826844558 cell2-jose touceda aylesbury buckinghamshire
2035142323 Government military
Number popularity chart 1162867384
Your opinion about telephone number 1162867384 (116 286 7384)
Reverse Phone: Check phone number from Leicester ??? Among the missed calls in saved reviews in our database by our users, you can usually meet all kinds companies and institutions such as offices, courier companies, transport companies, telemarketing, insurance companies, sales by telephone, consolidation loans, cash loans and payday loans as well as mobile telephony (Orange, T-mobile) calling us with a new offer. It is in these departments that many calls are often executable, but often after calling back on a given phone number, no one answers or We connect directly to the central where we do not know who called us. 995 country code. In this situation, the best solution is to find an opinion on a given telephone number, to know who called us and whether we should call back or next time we answer the phone.
Possible number records of 01162867384 01162-867-384
+441162867384 |
00441162867384 |
1162 867 384 |
11 62 86 738 4 |
116 28 67 38 4 |
11-62-86-738 4 |
0044 1162-867-384 |
00 44 116 28 67 384 |
(+44)1162867384 |
11 62 86 738 4 |
(11) 6286 738 4 |
00 44 (11)6 28-67-38-4 |
+441162867384 In words... 116 286 7384
one thousand one hundred sixty two eight hundred sixty seven three hundred eighty four |
one billion one hundred sixty two millions eight hundred sixty seven thousand three hundred eighty four |
Possible number records of 1162867384
Last rated phone numbers
7399183893, 1135349146, 7404665257, 7702519784, 1442255422, 1822874751, 7477458572, 2921280155, 7553324573, 1214681657, 1324232034, 1827216401, 7482766278, 7932213339, 1223217746, 7765746464, 7719108109, 7719108109, 7719108109, 2080793071, 7883305092, 7893056461, 1623829653, 1162764164, 7477451471, 7455397029, 1162547383, 2045716901, 2476396145, 7359838881, 7359838881, 3300430239, 7838562185, 3456723723, 918013550295, 7712378436, 7917208826, 2045790585, 1214681657, 7860099938, 7359027357, 7359, 1904736807, 1915800082, 1908103710, 1873440629, 7451287719, 7418370139, 1633603534, 1908103227,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985033768
- Pageviews today : 491778
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1162867384
+441162867384
Was I interested in investing with Frontis Capital ? Like why would I invest with someone who a) I'd never heard of and rings me randomly out of the blue b) who come on m...
Debt collector, Idem servicing
Automated message saying I had been involved in an accident
compensation claims
Lyons holiday parks doing "courtesy calls" cold callers don't bother answering
Called at 07:50 20/03/18 no noise they put phone down.
Got dead threaths from this number by whatsapp and told to pay money.
Very trustworthy
Started by asking to speak to the business owner which ia a red flag for me then claimed to be from google, back down when queried and said they were a partner, then becamse abusive when I asked them to not call again. Blocked
Fraud
donald brown banchory aberdeenshire
Scam
christopher elliott chester chester
pie enterprises ltd london london
phone once then phoned again to say he didn't like the tone of my voice
+44 7858 129389 This number is being used to fetch and scamming money posing as traveler and investor
This number I believe belongs to a double glazing window sales company - Safe Style UK or Instyle UK.
48litresoffunk cardiff n a
Scam
no one answers when you pick up phone
London
The same happened to me today. When I telephoned GWH I got an automated reply that it was just a courtesy call and there might be a further call later. A phone number was give...
If this number rings you again either answer by saying bonjour then speak as though you are French or German .if this doesn t work tell them you now have their number and will be taking them to the small claims court for harrasment or better still start swearing as though you have Tourette s
SCAM
I received an email from this same guy called Tony yesterday afternoon. I suspected the email straightaway. I called the number, went to a recorded advert, I quickly cut the call off after 1min 22secs. It is a scam!!!! Please beware of this guy and/or related tricks.
SPAM
Telemarketing
London
south
Silent call
Manchester
Missed call
This is one of several numbers that began making repeated calls to my mobile after I had used RAC recovery to move my car following a skid into a kerb in the snow. The RAC denied passing on my details but did so to its recovery subcontractor and to a third party company it employs called Sigma. The caller refused to identify themselves and rang off when I asked for them. They used some generic name like National Accident Database.
This is Halifax / Bank of Scotland / Lloyds Bank complaints department. If they're calling you then you must have logged your phone number with them and made a complaint.
Courier
SCAM - Recorded message claiming to be from HMRC. Blocked and reported.
black dog clinic london n a
cell2-jose touceda aylesbury, buckinghamshire
Fraud threats claiming to be from national insurance department
IT'S A DANGEROUS SCAM! A computer is dialling numbers in sequence to sniff out voice lines. If you speak then the line is detected as 'an active voice line' and logged as such, a scammer will then be calling you later! If you don't recognize the number calling DON'T SPEAK, JUST LISTEN! If you don't hear a voice and then the line goes dead then congratulations - you have just successfully escaped being scammed! THESE CALLS ARE HARASSING AND ALWAYS POTENTIALLY DANGEROUS!
Stef defo works for them lol mug
reece whittington hounslow greater london
they call me at least twice a day from all different numbers but as yet I have not answered any of them as they are from a debt that was about ten years ago which is past the statute of limit
SCAM
Unknown caller called at 11.00 on Sunday 9th November at the start of the Rememberance 2 minute silence very disturing
Scam. Claiming to be BT wanted access to me pc computer Abusive when challenged Why does BT allow these numbers to be exploited
miguel mansfield london xx
Called my mobile. "Hiya" identified as Suspected Spam, London based number. Whoever it was hung up on me answering. Now blocked just because they hung up without speaking.
SCAM
Fraud
equation pictures ltd london london
ppi scam
Fraud
Chobham
SCAM fake google ads call
Rye
SPAM
fitness matters st. helens msy
My wife gave me a look of surprise today. We had just finished scanning a forty page service manual for a customer who wanted a printed copy posting. Is was getting near the cut off time for the post office, and the laser printer had decided that its drum was reaching the end of its life leavening splodges on the pages. Suddenly the phone rang, I answered it and after about ten seconds said F--- OFF James and slammed the phone down. What my wife did not hear was the sound of a call centre and a
London
international academy of science and higher education limited london london
the bead and jewellery shop ltd east twickenham
answer machine
SCAM. Technical dept at BT not! Asian voice, illegal call as my no is tps listed.
Nottingham
Rung twice in less than an hour hung up when I answered call
Missed call
ely
Felixstowe
Finchley
I am a talktalk customer, and also registered with the TPS but still they call nearly every day.I have asked them not to call and told them about TPS but it makes no differance.
Leeds IAPT mental health service.
Scam caller
Manchester
Phone to abuse
Robotic voice say thank you for order placed from amazon saying I have been charged
SCAM 00916578085510 SCAM OPENREACH CALL, Claiming my Internet is being terminated.
SMS calming to be from Lloyds saying "A payment was attempted from a NEW DEVICE on 31/03 at 15:25:16. If this was NOT you, please visit https://Lloyds.actions-device.com" Looks highly dodgy!
Somebody just called asked my name and when i said Yes that me they hanged up.
SCAM
sailing given time bristol
declined to refund money sent wrongly
0927248331
mind bubble learning ltd southampton hampshire
Been rang three times by this number twice they hung up as I answered. Not calling back in case it s a scam. If anyone has anymore info please share.
Blocked. Robocall/scam.
Called ,one ring then hung up. Anyone else had this happen on this number
hummingbird sua ltd plymouth devon
Spamming me every day from this number with a recorded voice. Am TPS registered so have complained to ICO too.
london
waltham cross
Telemarketing
kola adebayo grays grays
SCAM / SPAM
Harringtons Advisory Manchester based company using spoof local dialing code number. PPI company. Reported to OFCOM.
Safe number
classic vehicle solutions horsham
nuisance silent calls. also any time of day up to 8pm. do not respond to them.
The overall rating for phone number 08000232635 is Neutral
Don't know this number