1752291852 (01752291852)
Who called me from phone number 1752291852 Plymouth
Who called me from 1752291852
Phone number 1752291852 it's a landline number from Plymouth. This phone number has been searched 1 times. The first search was on 2026-02-16 10:54:44 and the last on 2026-02-16 11:55:44. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1752291852 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441752
Phone number 1752291852 - 0 opinions
Reviews for phone number 1752291852
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1752291852
QR Codes for number +44 1752291852




Phone number 1752291852 (+441752291852)
Country: United Kingdom
Country code: +44 (0044)
City: Plymouth
Directional local: 1752 (01752)
Code: 441752 (00441752)
This number was searched 1 times
First date of search: 2026-02-16 10:54:44
Date of last check of this number: 2026-02-16 11:55:44
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 581922571
A similar number: 17522947, 175229142, 175229204, 175229930, 176829185, 176829185, 179429185, 175329185(17 52 29 47,17 52 29 142,17 52 29 204,17 52 29 930,17 68 29 185,17 68 29 185,17 94 29 185,17 53 29 185)
Previous phone numbers: 1752291851 1752291850 1752291849 1752291848 1752291847 1752291846 1752291845 1752291844 1752291843 1752291842 1752291841 1752291840 1752291839 1752291838 1752291837 1752291836 1752291835 1752291834 1752291833 1752291832 1752291831 1752291830 1752291829 1752291828 1752291827 1752291826 1752291825 1752291824 1752291823 1752291822 1752291821 1752291820 1752291819 1752291818 1752291817 1752291816 1752291815 1752291814 1752291813 1752291812 1752291811 1752291810 1752291809 1752291808 1752291807 1752291806 1752291805 1752291804 1752291803 1752291802 1752291801 1752291800 1752291799 1752291798 1752291797 1752291796 1752291795 1752291794 1752291793 1752291792 1752291791 1752291790 1752291789 1752291788
Next phone numbers: 1752291853 1752291854 1752291855 1752291856 1752291857 1752291858 1752291859 1752291860 1752291861 1752291862 1752291863 1752291864 1752291865 1752291866 1752291867 1752291868 1752291869 1752291870 1752291871 1752291872 1752291873 1752291874 1752291875 1752291876 1752291877 1752291878 1752291879 1752291880 1752291880 1752291881 1752291882 1752291883 1752291884 1752291885 1752291886 1752291887 1752291888 1752291889 1752291890 1752291891 1752291892 1752291893 1752291894 1752291895 1752291896 1752291897 1752291898 1752291899 1752291900 1752291901 1752291902 1752291903 1752291904 1752291905 1752291906 1752291907 1752291908 1752291909 1752291910 1752291911 1752291912 1752291913 1752291914 1752291915 1752291916 1752291917 1752291918 1752291919 1752291921 1752291921 1752291922
(Previous phone numbers: 01752291851 01752291850 01752291849 01752291848 01752291847 01752291846 01752291845 01752291844 01752291843 01752291842 01752291841 01752291840 01752291839 01752291838 01752291837 01752291836 01752291835 01752291834 01752291833 01752291832 01752291831 01752291830 01752291829 01752291828 01752291827 01752291826 01752291825 01752291824 01752291823 01752291822 01752291821 01752291820 01752291819 01752291818 01752291817 01752291816 01752291815 01752291814 01752291813 01752291812 01752291811
Next phone numbers: 01752291853 01752291854 01752291855 01752291856 01752291857 01752291858 01752291859 01752291860 01752291861 01752291862 01752291863 01752291864 01752291865 01752291866 01752291867 01752291868 01752291869 01752291870 01752291871 01752291872 01752291873 01752291874 01752291875 01752291876 01752291877 01752291878 01752291879 01752291880 01752291880 01752291881 01752291882 01752291883 01752291884 01752291885 01752291886 01752291887 01752291888 01752291889 01752291890 01752291890 01752291891)
+44 01752291852 reviews
Add your opinion about +441752291852
UK 1752291852
telephone number lookup reverse
Who called from number 1752291852
You can rate other simmilar phone numbers from Plymouth, searched in our database
| 1752256412 | 1752259578 | 1752228528 |
| 1752496856 | 1752530136 | 1752519385 |
Random searched phone numbers
| 767 929 4405 | 671 167 0992 | 260 565 5083 |
| 686 692 2504 | 518 506 628 | 454 372 0141 |
Top rated phone numbers
8435525267 Rang twice and hung up I saw it was a premium number so did not answer The best way to notice a scam call is when the caller asks for you by surname which they cannot pronounce probably because the forename is not mentioned in the records as they see them Then scammers ALWAYS ask how you are which is often when they try pulling up more details from the records2084552224 Scam
7901394872 SPAM Chinese automated message
1216629017 called received 0728am today 2522023 checking who called me this makes 3 calls in hour logged caller claimed to be bank and reported unusual activity on my account SCAM
2086700217 the music network london south london
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
81300324578 Scam
1294681617 Usual you ve had an accident rubbish
1628861503 This caller is from a company called Whistle a comprehensive postal solution company I spoke to a sales person going by the name of Jake Pollyblank well manered not pushy o
7984545157 SCAM - sent scam text message to me pretending to be Vodafone asking for me to click on link to a website
2080722742 Hung up the moment I answered
2033761451 this is a payday express number they have over 50 as they pretend to be located in different area codes to make you pick up the phone i will go through and add comments on all
7751978648 07706874762
2078983698 SCAM Automated fake call from HMRC threatening legal action annoying and definitely not legitimate
7801445852 Manchester
967733313619 welcome We are pleased to inform you that the cost of tracking the traffic of WhatsApp data No 967733313619 and the details of the phones used to operate it with tracking and opening a loophole for the operator of the phone number 016579991968 as a fake number 52 US dollars we will open a loophole as soon as we receive a notification to pay the amount to the account ABAN AL61190430023457891 Happy to serve you
2073525696 sea whisker films london london
1223782408 01223 782408amp13nThis call was supposed to be from amazon saying somebody had used my account for a purchase this morning I couldn t hear her properly and asked her to speak
7445254890 website kimpton aberdeenshire
75273550 Blackmail
1604314006 who called me from 01604 314006
1442781048 My phone showed me that is a spam suspicious call so I didnt answer it Blocked
3793418972 Said they were calling about BT internet I don t have BT
3332029784 We had this as well regularly until about a year ago We also are not with Scottish Gas although we are with British Gas They also left regular automated messages about meter
7921109284 fleming private office ltd maidstone kent
1217125431 Automat
1340074481 told me he was a technical support team and they c i have trouble with my windows on my computer i told him i have no computer u don039t was his reply and he dropped the
2073523918 SCAM Apparently HMRC going to suspend my National Insurance number
7868709095 london
7872378635 SCAM certified imbecile
Number popularity chart 1752291852
Your opinion about telephone number 1752291852 (175 229 1852)
Tags for called.co.uk: Telephone number lookup reverse 1 7 5 2 2 9 1 8 5 2, 01752291852, check mobile number,who called me,whose number is this,check phone number,check phone number owner,check telephone number,company phone number lookup, reverse cellphone lookup free results with name, unlock cell phone, virtual phone number free, best htc smartphone, telephone directory gujarat, iphone serial number info, how to find unknown number location, , find address from phone number,find mobile number,find phone number by name,find phone number owner,find telephone number,how to track a phone number,mobile number tracker,mobile phone checker,mobile phone number,mobile phone number tracker,number finder,number search,online phone number,phone book,phone directory,phone line checker,phone number address,phone number checker free, phone number identifier,phone number lookup,phone number search,phone number search by address,who called me uk,phone number tracker,residential phone numbers,reverse lookup,reverse phone lookup,telephone directory,telephone number,telephone number trace,who number is this,who's telephone number is this?
Possible number records of 01752291852 01752-291-852
+441752291852 |
00441752291852 |
1752 291 852 |
17 52 29 185 2 |
175 22 91 85 2 |
17-52-29-185 2 |
0044 1752-291-852 |
00 44 175 22 91 852 |
(+44)1752291852 |
17 52 29 185 2 |
(17) 5229 185 2 |
00 44 (17)5 22-91-85-2 |
+441752291852 In words... 175 229 1852
one thousand seven hundred fifty two two hundred ninety one eight hundred fifty two |
one seven five two two nine one eight five |
Possible number records of 1752291852
Last rated phone numbers
2840680064, 2086385837, 7852529354, 7307352368, 7359638650, 1224050530, 7398956960, 7893919337, 43777178127, 2070819980, 7706291709, 2034815528, 7934244452, 1443557006, 1303862549, 1279713750, 7368878779, 7541198239, 7476372727, 2083926909, 1416287560, 7521763002, 1244757126, 8004643136, 7488838887, 7801174594, 420414529997, 919136528465, 1642844170, 1416286681, 2045866037, 33017488896, 1912850664, 7961476779, 2031293032, 7731580046, 2045206079, 7375990206, 1604821234, 7471433059, 7471433059, 1217842830, 2076246906, 1604779440, 7519739849, 7790994982, 12037986146, 3301748895, 7443751910, 7944885123,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13304
- Users online : 174
- Bots online : 13130
- Google Bots : 1
- Unique users : 140
- Unique bots : 443
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985162624
- Pageviews today : 620634
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1752291852
+441752291852
Yet another call from American accented woman telling me Amazon Prime was about to be cancelled.
Cslled me saying the wanted money for tax
The overall rating for phone number 03450760274 is Harassing
We had this as well, regularly until about a year ago. We also are not with Scottish Gas, although we are with British Gas. They also left regular automated messages about meter...
Silent call nuisance.
spencer mehlman loughton essex
highground property investment limited eversley hampshire
Bedfordshire
CHESTER
01619145308 grrrrrrrr as soon as I realised it was a spam call I proceeded to inform the young lady that my number was part of TPS and they should not be calling me. She said ...
Friendly number
London
Silent call heavy breathing
Pretending to be O2.
masf
Marketing nuisance
sarah-jane evans york north yorkshire
Automated; claims an order was made through your Amazon Prime account and you will be charged for iit
nascent vek consulting limited london
continuous flow upton upon severn worcestershire
I just received a phone call from 01613960104 during work hours, I explained kindly that I can't entertain the call and to please remove me from the calling list as it'...
Calling saying they were from Currys / PC World , accent suggested Indian caller, Currys / PC World do not have permission to call me - caller hung up when challenged on this. I suspect it was a scam call (your PC is infected with a virus type scam)
the music network london south london
vinodh
Never heard of Nexbridge Until I Google d them. They don t speak nothing,the line just stays Quiet. They will phone you 3 or 4 times a day and it s always the same... No one speaks
Internet
[email protected]
it s akinika - used to be iQor. They collect on government debts but are still bound by OFT (now fca)debt collection guidance.
Fruadster buys items from you then says he never received them when he definitely did so PayPal refund him. Do not trust him stung me for a low amount luckily.
Millie Accident chasing
7940447791
Company called true hrd advice, obvious scam. AVOID
Silent call
Silent call caller hung up after answering
SCAM Claimed to be Lloyds saying I had an attempted payment to MR A JONES
I agree with comment 1 I have spoken to my telephone company who agree, I've blocked further calls from this number.j
Watford
Call received on my mobile, female with an English voice claiming to be from Sky something or other, asking me to confirm about the accident I'd been involved in (naturally...
dilan koca london
SCAM Scamming call centre of ladies pretending to represent Aldermanbury Investments. The real Aldermanbury Investments do not do business with the public as they are part of J P Morgan's BIG business empire. YOU HAVE BEEN WARNED!
left a message saying to call back and said it was not a sales call..very suspicious about it,havent called it back.
Complete load of rubbish and scam. Blocked.
Scammer - have you been in an accident etc.
Caller hangs up as you answer. Judging by lots of calls I've had from similar numbers (all about accidents you've never had) they have a loads of lines and just change...
Scam msg from 60693 Hey Astrid, you can replace your old phone for a brand new one: 8uy.me/hpcnH
london
Halifax
Positive number
Bristol
Holton Heath / Poole
Traced no to student accommodation Queensland place 2 Chatham pl Liverpool L 7-3AA said they were something to do with Internet so I hung up sounds like a scam
Scam, stay away from this company, fake loans company, will promise a loan and steal your money!
SCAM
These guys offer a supposed Nuisance Call Blocker service but the only nuisance calls I get are from these people. They call 5-6 times a day no matter what I do or say.
SCAM / SPAM Claiming to be from HMRC re a tax fraud I have participated in. Threatening auto call wanting me to press digits to interact!
Positive number
Jigsaw24 computer company. http://jigsaw24.com/
The following steps are suggested:
SCAM
SCAM Claim a ‘Criminal Case’ has happened in your name, police have a warrant to arrest you to immediately stop this warrant press 1 and immediately pay £100
Private number
Was suspicious so didn't answer.
The overall rating for phone number 07307810357 is Neutral
Fraud Tax number scammer
Ely
Dilwyn
this nombor ask me to pay for custom clearance (RM2500) and his voice like robot machine..my boss check and all this is illegal syndicate..be more cafeful to others..
Surrey
derek kirk london london
Fraud, call advising a govt case was started against me and I should press 1 to learn more
Missed call, seems to call often
SCAM Recorded Message claiming to be from National Crime Agency about your Nat Insurance. BIG SCAM LEAVE ALONE BLOCK DELEAT.
Nasty woman called Alison , claimed she was a BNP candidate and went on about how brown people were taking over the country! I said stop right there and argued with her for 10 mins ! Horrible racist rant . Do not answer this number if you are easily offended ! As I was .
Garbled message informed me that HMRC was taking me to court and I should stay on the line to speak to a legal representative, when I did I was connected to someone who spoke po...
Received a call from this number I tried calling back no mention of a company or anything, just says "your call is very important to us please wait for Ana available agent&...
Called to confirm domain. Legit and all good :)
Don't know who this is, they did not leave a message, I rang it because I have business in wales yet I was on hold for 5 mins with no answer and no explanation to who they...
Rochester
Silent call
These people have conned my mum into signing for £3844 for a adjustable bed. Knocked£1000. Off for discount and took a deposit of £695 from her. I will be trying to stop this tomorrow. Watch this space. She is nearly 80 and preyed on by a woman. Disgraceful.
صوت
NINO fraud
candle affinity tavistock dev
Fraud SCAM SPAM This number belongs to an organization funded by drug sales and is used to scam you and possibly execute fraud on your bank account and/or credit cards. If the number is exposed, they just generate a new number and continue scamming people in the US. the actual number is mirrored to a us number to hide it's origin.
altitude internet stansted
London
Silent call
Silent call
Unrecognised when rung back
tsm builders paisley renfrewshire
Calling several times a day and leaving voicemails about my home energy supply. I swear every time I open my phone I have a voicemail.
Who is calling me im really fed up of these nusiace calls
Spam
Fraud Automated voice recording saying my National Insurance number is compromised, press 1 to speak to the legal investigation officer handling the claim
THIS IS A FRAUDULENT COMPANY DO NOT PART WITH MONEY THEY ARE NOT REGISTERED WITH THE FCA OR COMPANYS HOUSE! THEY ARE LYING! THEY WILL CALL YOU RUDE NAMES WHEN YOU SAY NO!
Lloyds bank scam
No answer just Asian voices in background
earthly orbit communications ltd crabtree lane, headley hants
07706874762
Private number