1752919854 (01752919854)
Who called me from phone number 1752919854 Plymouth
Who called me from 1752919854
Phone number 1752919854 it's a landline number from Plymouth. This phone number has been searched 1 times. The first search was on 2026-02-16 08:36:07 and the last on 2026-02-16 09:37:07. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1752919854 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441752
Phone number 1752919854 - 0 opinions
Reviews for phone number 1752919854
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1752919854
QR Codes for number +44 1752919854




Phone number 1752919854 (+441752919854)
Country: United Kingdom
Country code: +44 (0044)
City: Plymouth
Directional local: 1752 (01752)
Code: 441752 (00441752)
This number was searched 1 times
First date of search: 2026-02-16 08:36:07
Date of last check of this number: 2026-02-16 09:37:07
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 589192571
A similar number: 17529199, 175291512, 175291664, 175291208, 173491985, 173491985, 177591985, 173991985(17 52 91 99,17 52 91 512,17 52 91 664,17 52 91 208,17 34 91 985,17 34 91 985,17 75 91 985,17 39 91 985)
Previous phone numbers: 1752919853 1752919852 1752919851 1752919850 1752919849 1752919848 1752919847 1752919846 1752919845 1752919844 1752919843 1752919842 1752919841 1752919840 1752919839 1752919838 1752919837 1752919836 1752919835 1752919834 1752919833 1752919832 1752919831 1752919830 1752919829 1752919828 1752919827 1752919826 1752919825 1752919824 1752919823 1752919822 1752919821 1752919820 1752919819 1752919818 1752919817 1752919816 1752919815 1752919814 1752919813 1752919812 1752919811 1752919810 1752919809 1752919808 1752919807 1752919806 1752919805 1752919804 1752919803 1752919802 1752919801 1752919800 1752919799 1752919798 1752919797 1752919796 1752919795 1752919794 1752919793 1752919792 1752919791 1752919790
Next phone numbers: 1752919855 1752919856 1752919857 1752919858 1752919859 1752919860 1752919861 1752919862 1752919863 1752919864 1752919865 1752919866 1752919867 1752919868 1752919869 1752919870 1752919871 1752919872 1752919873 1752919874 1752919875 1752919876 1752919877 1752919878 1752919879 1752919880 1752919881 1752919882 1752919882 1752919883 1752919884 1752919885 1752919886 1752919887 1752919888 1752919889 1752919890 1752919891 1752919892 1752919893 1752919894 1752919895 1752919896 1752919897 1752919898 1752919899 1752919900 1752919901 1752919902 1752919903 1752919904 1752919905 1752919906 1752919907 1752919908 1752919909 1752919910 1752919911 1752919912 1752919913 1752919914 1752919915 1752919916 1752919917 1752919918 1752919919 1752919920 1752919921 1752919923 1752919923 1752919924
(Previous phone numbers: 01752919853 01752919852 01752919851 01752919850 01752919849 01752919848 01752919847 01752919846 01752919845 01752919844 01752919843 01752919842 01752919841 01752919840 01752919839 01752919838 01752919837 01752919836 01752919835 01752919834 01752919833 01752919832 01752919831 01752919830 01752919829 01752919828 01752919827 01752919826 01752919825 01752919824 01752919823 01752919822 01752919821 01752919820 01752919819 01752919818 01752919817 01752919816 01752919815 01752919814 01752919813
Next phone numbers: 01752919855 01752919856 01752919857 01752919858 01752919859 01752919860 01752919861 01752919862 01752919863 01752919864 01752919865 01752919866 01752919867 01752919868 01752919869 01752919870 01752919871 01752919872 01752919873 01752919874 01752919875 01752919876 01752919877 01752919878 01752919879 01752919880 01752919881 01752919882 01752919882 01752919883 01752919884 01752919885 01752919886 01752919887 01752919888 01752919889 01752919890 01752919891 01752919892 01752919892 01752919893)
+44 01752919854 reviews
Add your opinion about +441752919854
UK 1752919854
4g phones
Who called from number 1752919854
You can rate other simmilar phone numbers from Plymouth, searched in our database
| 1752929109 | 1752960170 | 1752978674 |
| 1752606115 | 1752156432 | 1752990789 |
Random searched phone numbers
| 229 570 0839 | 404 343 1612 | 273 838 5152 |
| 890 030 6059 | 523 801 92 | 327 590 1277 |
Top rated phone numbers
2380894445 Telemarketing7814518457 Scam
7535766950 SCAM Royal Mail scam sending texts and doggy links
1689343034 01689 343034 same got miss call on my mobile did039t call back assumed was a con or prank
1924919624 Just received call from this number Didn t answer and no message left I rang 1471 and obtained number and rang it three times and it was a dead line
9215781982 Scam
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
3475376620 be happy
1615244134 ITS A DANGEROUS SCAM A computer is dialling numbers in sequence to sniff out voice lines If you speak then the line is detected as an active voice line and logged as such a scammer will then be calling you later If you dont recognize the number calling DONT SPEAK JUST LISTEN If you dont hear a voice and then the line goes dead then congratulations - you have just successfully escaped being scammed THESE CALLS ARE HARASSING AND ALWAYS POTENTIALLY DANGEROUS
7599831692 Lytham St Annes
7787121897 bigspring uk ltd nottingham nottinghamshire
2072192255 Silent call
1619744205 cold calling tossers They should be shot
2038874726 Fraud
7780043135 I received a text supposedly from HSBC advising me that a quotpayment was attempted to a new payeequot and including the following linkhttpshs-mobilebanking-paymentsupportcomhsbcloginThe link page it directs you to looks the same as the genuine HSBC login page BUT it is a hoax - DO NOT USE THIS WEBPAGE TO ACCESS YOUR ACCOUNTAs I said it looks good but the give-away is the fact that the links on the page do not work
9667838230 Telemarketing
7990067450 Paid number
7537182243 SCAM Claimed to be Denise Couchman but also Linda Carrigan Said that shes the owner and wants to rent out her property because shes moving to her family due to her hearing problem Asks to send deposit before viewing BE CAREFUL DONT SEND YOUR DETAILS AND YOUR MONEY
7538190404 Pretending to be Royal mail is a scam be careful
7714164686 BankLonas
8000232635 The overall rating for phone number 08000232635 is Neutral
7960508323 green planet ventures camberley surrey
7865499997 bablu uddin london london
7925829821 Altrincham
7792009232 Leeds
1206688002 Keep ringing me and hanging up Wish someone would do something about these people
7483825105 SCAM TAXES HMRCScam calling saying warrant out for outstanding taxes
7918731357 West Malling
1245454705 Car going in for service salesman looking for more business
1752463643 hummingbird sua ltd plymouth devon
Number popularity chart 1752919854
Your opinion about telephone number 1752919854 (175 291 9854)
Tags for called.co.uk: 4g phones 1 7 5 2 9 1 9 8 5 4, 01752919854, check mobile number,who called me,whose number is this,check phone number,check phone number owner,check telephone number,company phone number lookup, how to call international, what are the best cell phones, what is this telephone number, figure out whose number it is, find me app android, play store on, top 5 android smartphones, , find address from phone number,find mobile number,find phone number by name,find phone number owner,find telephone number,how to track a phone number,mobile number tracker,mobile phone checker,mobile phone number,mobile phone number tracker,number finder,number search,online phone number,phone book,phone directory,phone line checker,phone number address,phone number checker free, phone number identifier,phone number lookup,phone number search,phone number search by address,who called me uk,phone number tracker,residential phone numbers,reverse lookup,reverse phone lookup,telephone directory,telephone number,telephone number trace,who number is this,who's telephone number is this?
Possible number records of 01752919854 01752-919-854
+441752919854 |
00441752919854 |
1752 919 854 |
17 52 91 985 4 |
175 29 19 85 4 |
17-52-91-985 4 |
0044 1752-919-854 |
00 44 175 29 19 854 |
(+44)1752919854 |
17 52 91 985 4 |
(17) 5291 985 4 |
00 44 (17)5 29-19-85-4 |
+441752919854 In words... 175 291 9854
one seven five two nine one nine eight five |
seventeen fifty two ninety one ninety eight fifty four |
Possible number records of 1752919854
Last rated phone numbers
2475901471, 1172054793, 7772529358, 7751132922, 7712933177, 7724896633, 3330456786, 7733850572, 7733850572, 2045251410, 63366, 7473520447, 7369285599, 7554414092, 1223447532, 3303413407, 1482293843, 7778399189, 7448633179, 7545437254, 7448073974, 7902860110, 7466888519, 7763485701, 2080972460, 7745268386, 7799148002, 7974638469, 7716579373, 7878965412, 7538713161, 7939237011, 7536211388, 7545167386, 7527929999, 7745268386, 7536211388, 7742665280, 7512602075, 7728320673, 7545437254, 7466888519, 7728320673, 1243553951, 2037691834, 7709595718, 2922722090, 7964986532, 7359860140, 1644216392,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985039838
- Pageviews today : 497848
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1752919854
+441752919854
as above several missed calls, goggled and found above
SCAM, it keeps charging me £4.50 for sending me textsi have NOT subscribed to nor received and ALL attempts to send, STOO to this number has failed, I'm at my wits end with this
SMETHWICK
Devizes
SCAM / SPAM Loft insulation scam.
Josh from carphone warehouse
SCAM
Female with Indian type accent. Said something about mobile phone contract. Hung up and blacked number.
I'm so sick of this ridiculous behaviour, it's the way they just keep on reading the script without a pause for breath. I missed a call from them on Friday and the...
Dunstable
Epping
Called an asked my name immediately. As as soon as as I said whose calling they hung up. They didn t identify themselves either. Tip: don t answer to your name just ask whose calling before speaking to them.
Positive number
Bagshot
Fraud - Pretending to be from EE
Automated recording trying to sell PPI mis-selling claim service, even though phone number is registered with TPS
SPAM Sating it's carphone warehouse
Called from btc claims, unsolicited call. Blocked and forgotten about!
mini robot ltd farlington hampshire
Woodsure Sales team line - calling regarding DEFRA Ready to Burn Scheme- spoke to Nikki,very friendly!
The overall rating for phone number 08082237401 is Harassing
s l wells carpentry tutts clump berks
Called the landline (again):-(
jay financial linton heath linton
Male with an Indian accent and poor mumbling speech saying that my postcode has been chosen for a special discount card with all kinds of wonderful offers relating to travel and...
Insurance Knew my first name Were checking about a life insurance policy I don’t have with them Polite when informing not interested, they said would delete number. However, unsure if they just want led confirmation of name even though unlikely
Silent call
mario yiannakou london london
Automated call claiming to be from the 'national crime agency' telling me that there is some issue with my national insurance number, so it going to be blocked (spam/fraud)
Fraud Sounded like a scam, claimed to be hmrc and if you didn't press one a fraud claim was being placed against you.
Didnt speak when spoken too, hanged up
Wishaw
please search number please
Missed call
This is NOT a trustworthy caller. They are pretending to be a Windows Technical Centre. It is a SCAM. (Re-reported as I misunderstood the rating previously)
Missed call
Recorded message stating from HMRC and if I do not press option 1 I will be arrested.When you call number back message is "this number is out of service"
Belfast
Unknown caller - recorded message
Spam
wolverhampton
SCAM A text message from "three" about cutting off my services and asking me to log on with a link. Never had an account with three
sk eng limited isleworth middlesex
Telemarketing
SCAM
Scammers who claim to be from "Telephone Preference Management" and try to get your debit card details on the pretext (ironically) of blocking nuisance calls. Preying on the elderly and gullible, as usual. Nasty.
I didn't pick up and no message was left. Assume this is the usual PPI or some other cold caller.
Feds say 39 arrested in 23 states USA .3 arrested in England in ID theft ring in USA. England and Germany the follow with the same numbers (001) (0044) (049) 02070606042 / 01618505451 / 08434106629 / 08434106729 / 08434101709 / 01229808179 / 08447044755 / 01204397400 / 07875595895 / 01512510373 / 03 336 00 512 / 01535358094 / 01789473836 / 01702214459 / 01613126506 / 01613128082 / 01744882949 for USA / England / Germany WARNING!!!
HAYWARDS HEATH
Manchester
find that they are only trying to fraud you any which way they can, making it look like a local number to seem genuine. reject the calls!!
SCAM
Warrington
3at3 ely
laverigifts london greater london
Henley-In-Arden
This number keeps calling about an amazon account asked them to stop calling but it continues sometimes several times a day along with different numbers
Silent call
Another number beginning 01757331. Suspicious they may be from same source as other numbers beginning thus.
Ring me at 6:06 on a Sunday morning. And put the phone done once I answered.
adam graves didcot didcot
calling 3 to 4 times a day they keep on asking for bank account details wont say what they want them for ....have blocked them on my mobile would suggest to other ppl to do the same
the animal b.r.i.d.g.e project hampton hill middlesex
SCAM
called to ask if I was ready to replace boiler after contacting them...like no I will contact gas board
SCAM - pretended to be British Telecom - telling me they were going to disconnect my landline because suspicious activity had occurred... I didn't listen to any more.
SCAM
Services
This number keeps ringing me and I dont know it.
Scam! Automated voice saying that my bank card had been used for a £300 Amazon Gift Card.
Keeps calling 3 or 4 times a day,really annoying blocked the number
What is it with people who phone, but NEVER leave any form of message? I am not ringing them back, and if they don't at least have the courtesy to tell me what they are calling about, then they are blocked!
Caller said she was from Faversham (01795)? She wanted to sell advertising, when I declined she then called me with dropped call 10 times!
Man called from First Response, asked for me by name saying it was about an accident I had “a while back” and was it me the reported it. He hung up when I said I didn’t know what he was taking about.
LONDON
phone once then phoned again to say he didn't like the tone of my voice
10
Indian accent, Microsoft scam. Block. Gave them mouthful, hung up, and before i could block them, they called back to admonish me for swearing at them hahahahaha.
SCAM Pretending to be HSBC
valerie taylor eastbourne east sussex
andrew ashworth southport merseyside
Saya ingin berbagi cerita kepada anda bahwa dulunya saya ini cuma seorang. penjual es kuter kelilin tiap malam. pendapatannya tidak seberapa dan. tidak pernah cukup dalam kebutuhan keluarga saya,, suatu hari saya dapat. informasi dari teman bahwa AkI NUGROHO bisa memberikan angka ritual/goib.100% tembus. akhirnya saya ikuti 4D nya dan alhamdulillah meman bener-bener terbukti tembus. saya sangat berterimakasih banyak kpd AkI NUGROHO.atas bantuan AkI saya sekarang. sudah bisa mencukupi kebutuhan keluarg
inland revenue legal action call. Should be a category for these
SCAM TAXES / HMRC Scam calling saying warrant out for outstanding taxes
Got dead threaths from this number by whatsapp and told to pay money.
Wrexham
Bank/Lonas
just keep calling and hanging up or asking for people that have never lived here
ben mitchinson kendal cumbria
A recorded message said that the call was from the National Crime Agency (UK) and that my social security number had been compromised. Clearly a scam, probably phishing for information.
SCAM Asian sounding male purporting to be from BT Openreach saying our internet speeds were markedly low and he could help with this problem. I said we regularly check our up and download speeds and as we're on Fibre to the Premises with BT our usual speed is around 400mbs. He put the phone down. I imagine he was going to ask for ££ to enhance our speed.
Fake HMRC call. Nice to see the fake reviews have been pushing this number along.
Crank abusive calls
Harringtons Advisory Manchester based company using spoof local dialing code number. PPI company. Reported to OFCOM.
Asking for someone who doesn't live at the property using a generic name passing on a hello
Portsmouth
01091352777
London
SCAM / SPAM HMRC TAX FRAUD ARREST IF NOT PICKED
I had call from the above number guy with an indian accent, hard to understand ntold me he was BT and having trouble with internet I said no i m not bt nHe siad ok your sky nI ...