1757725351 (01757725351)
Who called me from phone number 1757725351 Selby
Who called me from 1757725351
Phone number 1757725351 it's a landline number from Selby. This phone number has been searched 1 times. The first search was on 2026-02-16 08:32:29 and the last on 2026-02-16 09:33:29. We have 0 review for this phone number. The rating of this phone number on a scale of 1 to 10 is 0 opinions (There are no negative reviews for this number.) - When there are no reports of negative reviews for this phoine number, this number appears to be safe. If this number is not secure, please report it below..
1757725351 Trust level
100 %
Ranking:
Searched:
1
First search:
2026-02-16
Directional:
+441757
Phone number 1757725351 - 0 opinions
Reviews for phone number 1757725351
No comments have been added for this number yet! Share your information about this phone number and help others users of WhoCalledMeUk.co.uk. Adding a rating is free and easy! Thank you.
Delete review of phone number 1757725351
QR Codes for number +44 1757725351




Phone number 1757725351 (+441757725351)
Country: United Kingdom
Country code: +44 (0044)
City: Selby
Directional local: 1757 (01757)
Code: 441757 (00441757)
This number was searched 1 times
First date of search: 2026-02-16 08:32:29
Date of last check of this number: 2026-02-16 09:33:29
Phone number rating :
[Total ranking is the scale of attractiveness rating from 1 (low) to 5 (high)]
Reverse number: 535277571
A similar number: 175772270, 175772777, 175772220, 175772234, 178872535, 178872535, 177972535, 175172535(17 57 72 270,17 57 72 777,17 57 72 220,17 57 72 234,17 88 72 535,17 88 72 535,17 79 72 535,17 51 72 535)
Previous phone numbers: 1757725350 1757725349 1757725348 1757725347 1757725346 1757725345 1757725344 1757725343 1757725342 1757725341 1757725340 1757725339 1757725338 1757725337 1757725336 1757725335 1757725334 1757725333 1757725332 1757725331 1757725330 1757725329 1757725328 1757725327 1757725326 1757725325 1757725324 1757725323 1757725322 1757725321 1757725320 1757725319 1757725318 1757725317 1757725316 1757725315 1757725314 1757725313 1757725312 1757725311 1757725310 1757725309 1757725308 1757725307 1757725306 1757725305 1757725304 1757725303 1757725302 1757725301 1757725300 1757725299 1757725298 1757725297 1757725296 1757725295 1757725294 1757725293 1757725292 1757725291 1757725290 1757725289 1757725288 1757725287
Next phone numbers: 1757725352 1757725353 1757725354 1757725355 1757725356 1757725357 1757725358 1757725359 1757725360 1757725361 1757725362 1757725363 1757725364 1757725365 1757725366 1757725367 1757725368 1757725369 1757725370 1757725371 1757725372 1757725373 1757725374 1757725375 1757725376 1757725377 1757725378 1757725379 1757725379 1757725380 1757725381 1757725382 1757725383 1757725384 1757725385 1757725386 1757725387 1757725388 1757725389 1757725390 1757725391 1757725392 1757725393 1757725394 1757725395 1757725396 1757725397 1757725398 1757725399 1757725400 1757725401 1757725402 1757725403 1757725404 1757725405 1757725406 1757725407 1757725408 1757725409 1757725410 1757725411 1757725412 1757725413 1757725414 1757725415 1757725416 1757725417 1757725418 1757725420 1757725420 1757725421
(Previous phone numbers: 01757725350 01757725349 01757725348 01757725347 01757725346 01757725345 01757725344 01757725343 01757725342 01757725341 01757725340 01757725339 01757725338 01757725337 01757725336 01757725335 01757725334 01757725333 01757725332 01757725331 01757725330 01757725329 01757725328 01757725327 01757725326 01757725325 01757725324 01757725323 01757725322 01757725321 01757725320 01757725319 01757725318 01757725317 01757725316 01757725315 01757725314 01757725313 01757725312 01757725311 01757725310
Next phone numbers: 01757725352 01757725353 01757725354 01757725355 01757725356 01757725357 01757725358 01757725359 01757725360 01757725361 01757725362 01757725363 01757725364 01757725365 01757725366 01757725367 01757725368 01757725369 01757725370 01757725371 01757725372 01757725373 01757725374 01757725375 01757725376 01757725377 01757725378 01757725379 01757725379 01757725380 01757725381 01757725382 01757725383 01757725384 01757725385 01757725386 01757725387 01757725388 01757725389 01757725389 01757725390)
+44 01757725351 reviews
Add your opinion about +441757725351
UK 1757725351
smartphone application development
Who called from number 1757725351
You can rate other simmilar phone numbers from Selby, searched in our database
| 1757725445 | 1757786406 | 1757778245 |
| 1757344712 | 1757594167 | 1757742488 |
Random searched phone numbers
| 631 865 0219 | 669 452 3394 | 272 435 0219 |
| 154 484 2769 | 869 307 5822 | 498 283 284 |
Top rated phone numbers
1226164015 SCAM SPAM3331552939 The overall rating for phone number 03331552939 is Harassing
3442437777 The overall rating for phone number 03442437777 is Harassing
1484533502 This number called me and said my card had been used twice first for 500 than the second for 1000 with AmazonObviously a scam
420722130218 Positive number
7837560786 London
2476685716 The overall rating for phone number 02476685716 is Dangerous
7787513898 maidstone
7555225379 made easy concepts-domain for sale sketty swansea
7900568934 LONDON
1131511141 Automated call quotDear customer your internet connection is being disconnectedquot No indication of who was calling
2039545304 Fraud
1409334308 its a fradulant cost trap
7862098630 SCAM
8437240745 Only just turned 18 and already getting ppi calls
1214561301 Call received - asking me to call back with no details of who the caller was or what they want
919445106154 none
1752438100 Very trustworthy
2083104797 Despicable to ring at 714am to an elderly household when we are already in a state of panic about Covid-19 Asian sounding voice said ampquotcriminal activity on your computerampquot with call centre noise in background Let me have quite a rant He hung up when I said ampquotI know its not your failt youre probably paid peanuts its your boss who needs to be told hes behaviour is disgustingampquot Cone on international community get these parasites preying on extremely vulnerable pe
2030066199 HEALTH INSURANCE - SALES CALL
2274904564 I received a nasty little recorded call just now from someone claiming to be from HMRC IT seems a complaint has been raised against me and that I should press quot1quot for
2083707020 international academy of science and higher education limited london london
1134470119 quot Your insurance company has asked me to call you about your accident which wasn039t your fault quot quotNo they haven039t quot quot I can assure you t
8437240936 Asks me about a survey unsolicited calls
1613549905 PPI call Have had 8 or 9 missed calls - very persistant and pushy Had to ask several tumes for them to remove me from their lists
1515484086 Liverpool
1516014589 They wanted information on the road traffic accident I have not been involved in yet I guess they must be a clairvoyant agency
2086852517 SCAM tax scam from this number 02028652517 located in the area of trafalgar square today 17321
7709340809 Amazon Prime Scam Just hang up and blockhttpswwwlancslivenewslancashire-newsamazon-prime-phone-scam-warning-19732609
17 01752263260
Number popularity chart 1757725351
Your opinion about telephone number 1757725351 (175 772 5351)
Find Cell Phone Number: Who called from UK Selby ??? Who is calling from 01757725351?? On our site a very transparent way you will check the location of an unknown phone number as well as see the location on the map I check from what city was the connection I check the ranking of the given number his opinion comments and statistical data among others How many times a given Number unknown number was searched for how many views when was the first search date and when was the last search date of this phone number. Don't risk additional costs by calling or receiving a call from an unknown phone number. Always try to check unknown connections by phone numbers you have not seen or do not know yet. It is safe here to check the phone numbers in our database and on other websites. Smartphone application development. Tell your friends about our site and let me know that they can check every unknown number in our number database for free at any time at any time. We invite you to check phone numbers and add opinions.
Possible number records of 01757725351 01757-725-351
+441757725351 |
00441757725351 |
1757 725 351 |
17 57 72 535 1 |
175 77 25 35 1 |
17-57-72-535 1 |
0044 1757-725-351 |
00 44 175 77 25 351 |
(+44)1757725351 |
17 57 72 535 1 |
(17) 5772 535 1 |
00 44 (17)5 77-25-35-1 |
+441757725351 In words... 175 772 5351
one thousand seven hundred fifty seven seven hundred twenty five three hundred fifty one |
one seven five seven seven two five three five |
Possible number records of 1757725351
Last rated phone numbers
1615283903, 1274792475, 7533905808, 7961189138, 8000834114, 7587178583, 1903539837, 2871098562, 7886084028, 4915172166153, 72166135, 7454, 7368306262, 21679331406, 4915172166153, 2030494941, 2250556799195, 7368306262, 1619023758, 1553348318, 7491163443, 923038617132, 43720116869, 1223926355, 7927924100, 1733592291, 1294617144, 1889574360, 7732318505, 1415329232, 1407749355, 3301749742, 420414529917, 420414529909, 8663564527, 7518100545, 7864921393, 1908103575, 1212363955, 420414529909, 7970050143, 1159338000, 7359047697, 2036958830, 2045793564, 63366, 60249, 2080799635, 17828639622, 2039362601,Who's called me uk
Who visited this number
There are no registered visits for this number in the database.Online stats
- Total online : 13032
- Users online : 41
- Bots online : 12991
- Google Bots : 0
- Unique users : 31
- Unique bots : 322
Who called me
Welcome to Who Called Me UK website (called.co.uk) - United Kingdom Free Reverse Phone Number. Our reverse phone lookup tool will help you find out who called you. Start searching and add reviews for free.
Statistics
- Number of views : 985036651
- Pageviews today : 494661
- Number of comments : 2861796
- Positive ratings : 1267979
- Neutral evaluations : 899655
- Annoying ratings : 150900
- Dangerous assessments : 543262
1757725351
+441757725351
SCAM Royal Mail scam , sending texts and doggy links
get real stowmarket suffolk
SCAM / SPAM
SCAM
Fraud
opana eversley hampshire
Rang saying they were from Sky and asking about a problem with our internet. I hung up
Ignored this caller, as I don't know anyone in Northern Ireland.
andrewaz and associates newcastle upon tyne nbl
Caller with foreign accent said she was from BT and that there was something wrong with my internet. I said it was fine and hung up.
Bin foned 3 time this week by this number, I heard don't know how true it is but they want you to ring back as they charge a premium rate number
कविता फोन नंबर
pcc limited bath avon
SCAM / SPAM
Hiii
Henley-In-Arden
the chimney fella sutton sry
Asked to speak to me, so suggested wrong number - asked again, then hung up.
myminidisco.com shropshire midlands
Amazon Prime Scam. Just hang up and block https://www.lancs.live/news/lancashire-news/amazon-prime-phone-scam-warning-19732609
Positive number
SPAM
Early morning nuisance call
SCAM / SPAM stay clear
Saying they heard I’d been in a car accident! Barr this number!
proents leisure west midlands
Bank/Lonas
hunsbury heating northampton
Fake HMRC call. Nice to see the fake reviews have been pushing this number along.
SCAM
I’ve had a spate of calls this week. Here are the numbers: n01628 435057 Maidenhead n01585 143765 UK n01089 669067 UK n01361 962860 UK n01287 923999 UK n0121 539 8559 Birmingha...
AMAZON
Dagenham
EDINBURGH
SCAM
When I pick phone up cant hear anything then the phone goes dead. This number phoned me 3 times yesterday and 2 times today
Telemarketing
SCAM Chinese Facebook dating scam usually African Indian scammer
01752263260
javier rodriguez london n a
Fraud Automated from "HMRC" about a tax fraud case.
Caller hung up when answer phone kicked in. Don t know anyone from Retford so probably a scam
Spam
Another number beginning 01757331. Suspicious they may be from same source as other numbers beginning thus.
Crank abusive calls
hummingbird sua ltd plymouth devon
SCAM pretending to be from bank about large payment to go through. Do not press 1 !!!!
Claim to be working for Microsoft Corporation and that you have a software problem on your computer. Can become very unpleasant when challenged, including making threats. They a...
01204311832 be aware spam called multiple times claimed to be about life insurance but there not!
Agreesive selling, rude and abrupt male caller, Misleadingly twice said that the matter regarding pensions was urgent . Claimed to be the Pension Helpline .
Please take me off your mailing list. I do not want to recieve these calls
Silent call
SCAM This number is an automated message saying your NI number has been suspended for fraud. When the number is called back it is not possible to be connected Block
Once again the scammers have been found out by trying to 'represent' both Microsoft and TalkTalk. If I was that member of staff and Manchester Uni., Id be straight on ...
matt greaves stourbridge england
rakela hair fashion ltd westcliif-on-sea essex
+6593900902
I thought this was a cold call. Not the case. It belongs to Gledhill boiler company, who were trying to contact me about an issue with my boiler. This is a Blackpool based company.
"Our records tells us you have a had a recent car crash...". Scam.
SCAM
Hythe
SCAM
Fraud: as results show the number is located in Armenia, and i do not know anyone in Russia i would strongly suspect this is a scam/fraud dangerous number
mayuran kuhathasan harrow harrow
SCAM Person wanted to talk to me about Amazon shares. I told them that I do not hold any of those products and she hung up.
SCAM, phishing call
No one there called back and no answer prob scam have reported number
London
Robotic voice say thank you for order placed from amazon saying I have been charged
Motor ombudsman service
Birmingham
BIRMINGHAM
equation pictures ltd london london
Called at 07:50 20/03/18 no noise they put phone down.
Who number is this
I have 3 charges of 35pence on my phone Bill I know I didn’t ring this number. It’s an old bill so I don’t know what kind of call it was.
Got dead threaths from this number by whatsapp and told to pay money.
London
SPAM
Didn't answer
Been called by this number and was told they were a driving school who wanted my services as a driving instructor but sounded very unprofessional using the words "basically...
Banbury
Telemarketing
Fraud threats claiming to be from national insurance department
Stockton
0207-735-3020 Someone telephoned me today 12th April 2017 at 12:51 on that number which I did NOT recognise. Didn't pick up the telephone. Does anyone know who these ...
olaf hoeg ltd. eastbourne east sussex
n a finchley central greater london
Automat
A guy with an Indian accent called from this number, wanting to sell me an iPhone...but then he tried to have phone sex with me. I'm a guy, by the way. He wanted me to suck his dick, wanted to fuck me...I think the call only ended because his supervisor intervened. I swear, these call centre guys are a bunch of pervs!
Telemarketing
London
Hove
I left phone at home don’t recognise the number
Accident Insurance scam. Somehow they are able to have a 'local' number displayed on caller ID. Ask them for their address and correct phone number as you wish to repo...
Yet again this number rang and when I answered it was terminated at their end
Latest Microsoft scam International call they try to spoof a "local area code to get you to pick up, if recognise number pick up, if not they willleave a message if really have a reason to call you
gary prebble southampton
The overall rating for phone number 21658504114 is Dangerous
"We believe you have been involved in a car accident that was not your faulT